TD7 - Analyse de texte

Analyse de texte, TF-IDF, LDA, moteur de recherche, expressions régulières.

from jyquickhelper import add_notebook_menu

Nettoyer les données (regexp et nltk)

Mais avant tout, nous devrions augmenter la qualité de nos données (en améliorant les parsers et la liste des stopwords). C’est l’objet de cette section.

import json
from pprint import pprint

with open('./data_pocket.json') as fp:
    dict_pocket = json.load(fp)
dict_to_df = {}

keys = ['resolved_url', 'resolved_title', 'excerpt', 'tags']

for (k,v) in dict_pocket.items():
    dict_to_df[k] = dict(zip(keys, [v[key] for key in keys if key in v]))
import pandas as p
df_pocket = p.DataFrame.from_dict(dict_to_df, orient = "index")
resolved_url resolved_title excerpt tags
1003565100 Tutoriel Vidéo Apache CordovaIonic Framework Ionic est un framework qui va vous permettre d... {'mobile app': {'item_id': '1003565100', 'tag'...
1008275819 Color Hunt Home Create Likes () About Add To Chrome Faceb... {'lewagon': {'item_id': '1008275819', 'tag': '...
1011618630 Out-of-Core Dataframes in Python: Dask and Ope... In recent months, a host of new tools and pack... {'data science': {'item_id': '1011618630', 'ta...
1014684096 A/B Testing with Hierarchical Models in Python In this post, I discuss a method for A/B testi... {'abtest': {'item_id': '1014684096', 'tag': 'a...
1016233829 Getting started with the Web Getting started with the Web is a concise seri... {'documentation': {'item_id': '1016233829', 't...
import pandas as p
import ast
df_pocket = p.read_csv('./df_pocket.csv')
tags url excerpt title domain html_soup
0 ['mobile app'] Ionic est un framework qui va vous permettre d... Tutoriel Vidéo Apache CordovaIonic Framework {'h2': ['Petit', 'tour', 'du', 'propriétaire']...
1 ['lewagon'] Home Create Likes () About Add To Chrome Faceb... Color Hunt {}
2 ['data science'] In recent months, a host of new tools and pack... Out-of-Core Dataframes in Python: Dask and Ope... {'h2': ['Pubs', 'of', 'the', 'British', 'Isles...
3 ['abtest'] In this post, I discuss a method for A/B testi... A/B Testing with Hierarchical Models in Python {'h2': ['Recent', 'Posts'], 'h3': ['Related'],...
4 ['mdn', 'documentation'] Getting started with the Web is a concise seri... Getting started with the Web {'h2': ['Mozilla'], 'h3': ['How', 'the', 'web'...
df_pocket['html_soup'] = df_pocket['html_soup'].apply(lambda x : ast.literal_eval(x) if x != "scraper banned" else x)
df_pocket['tags'] = df_pocket['tags'].apply(lambda x : ast.literal_eval(x) if x == x else x)
tags url excerpt title domain html_soup
0 [mobile app] Ionic est un framework qui va vous permettre d... Tutoriel Vidéo Apache CordovaIonic Framework {'h2': ['Petit', 'tour', 'du', 'propriétaire']...
1 [lewagon] Home Create Likes () About Add To Chrome Faceb... Color Hunt {}
2 [data science] In recent months, a host of new tools and pack... Out-of-Core Dataframes in Python: Dask and Ope... {'h2': ['Pubs', 'of', 'the', 'British', 'Isles...
3 [abtest] In this post, I discuss a method for A/B testi... A/B Testing with Hierarchical Models in Python {'h2': ['Recent', 'Posts'], 'h3': ['Related'],...
4 [mdn, documentation] Getting started with the Web is a concise seri... Getting started with the Web {'h2': ['Mozilla'], 'h3': ['How', 'the', 'web'...
def nan_to_string(x):
    if x==x:
        return x
        return ''

title_string = ' '.join(df_pocket['title'].apply( lambda x: nan_to_string(x)))
import re
def url_cleaning(url):
    return ' '.join(re.split(r'\/|\.|\:|-|\?',url))

url_string = ' '.join(df_pocket['url'].apply(lambda x : url_cleaning(x)))
def hx_cleaning(d,hx):
    if str(hx) in d:
        return ' '.join(d[str(hx)])
        return ''

h1_string = ' '.join(df_pocket['html_soup'].apply(lambda x : hx_cleaning(x,'h1')))
h2_string = ' '.join(df_pocket['html_soup'].apply(lambda x : hx_cleaning(x,'h2')))
h3_string = ' '.join(df_pocket['html_soup'].apply(lambda x : hx_cleaning(x, 'h3')))
excerpt_string = ' '.join(df_pocket['excerpt'].apply( lambda x: nan_to_string(x)))
def p_cleaning(x):
    if (type(x) == dict) & ('p' in x ):
        return ' '.join(x['p'])
        return ''

p_string = ' '.join(df_pocket['html_soup'].apply(lambda x : p_cleaning(x)))
words = ' '.join([title_string,url_string,h1_string,h2_string,h3_string,excerpt_string])
# on ne conserve que les mots
words_string = re.sub('[^A-Za-z ]','', words)
#on "nettoie les espaces"
words_string = re.sub('\s+',' ', words_string)
'Tutoriel Vido Apache CordovaIonic Framework Color Hunt OutofCore Dataframes in Python Dask and OpenStreetMap AB Testing with Hierarchical Models in Python Getting started with the Web Le Wagon UI components shakacodereactonrails Le Wagon Alumni Nocturne Opus No Frederic Chopin Piano Tutorial Synthesia ES Promises in Depth Jupyter Notebook Viewer Introduction lanalyse de texte avec nltk Tokenization CamFind API Documentation Build an Elasticsearch Index with PythonMachine Learning Series Part The MustHave Discovery Tool for every Media Professional Python NLTK WTF Chapter Notes on things that dont work right Google Maps Geolocation Tracking in Realtime with JavaScript The Definitive Guide to Natural Language Processing lewagonrailsstylesheets Productivity Tips for Programmers with ADHD EquityOwl No Cash No Salaries Just Equity React For Beginners Learn Enough Text Editor to Be Dangerous Michael Hartl Mapbox The New WordPresscom Why Proxima Nova Is Everywhere PayByPhone Adds NFC in San Fran Google Wants to Fund App Developers for Project Tango Phone Project Tango Virtual and Augmented Reality for Mobile Phones Ubiquity Dev Summit Maps UI Kit conomie collaborative ou conomie du partage cherchez lerreur Backchannel Medium Rapport de Pascal Terrasse sur le dveloppement de lconomie collaborative OnePark lve millions deuros et vise parkings en Europe reduxServerRenderingmd at master reactjsredux GitHub Lconomie collaborative cest fini Accueil Setting Up Sublime Text forReactJS Rpublique Connexion Service worker toolkits and libraries The Web App Manifest Module CSS Slecteurs WC Setup Ruby On Rails on Ubuntu Xenial Xerus Speech API Adding a Service Worker and Offline into your Web App FantaisieImpromptu Opus Frederic Chopin Piano Tutorial Synthesia Feather A Fast OnDisk Format for Data Frames for R and Python powered by Apache Arrow Please log in houses Le setup des Meta Tags dans Rails Moonlight Sonata Complete Piano Tutorial Synthesia Sublime Tutor A free and interactive ineditor tutor for Sublime Text lewagonsinatra A software product design and development studio Should I use React ServerSide Rendering lewagonrailstemplates livecodelivecode RailsConf Turbolinks I Cant Believe Its Not Native by Sam Stephenson Instagram Search and Explore Lacrimosa Wolfgang Amadeus Mozart Piano Tutorial Synthesia Socialico Free font Will Elixir Phoenix destroy Ruby on Rails Comptine dun autre t Amlie Piano Tutorial Synthesia Building a Super Simple Rails API JSON API Edition The Stages Of A SaaS Company When To Scale For Success ddforce Home Action Cable Overview Ruby on Rails Guides Setting Up a Babel Project Vibe Morale Meter for Teams using Slack Heroes of the Frontier review Dave Eggers finds utopia in Alaska sudo npm command not found Coworking The One With a JSON API Login Using Devise Kundalini Awakening the Shakti Within Clustering and Solving the Right Problem Checkboxradio Formation Dveloppeur full stack JS carlsednaouiouicards What is Google Cloud PubSub Python Elasticsearch First steps Why Progressive Web Apps vs native is the wrong question toask Social Networks for Developers Hidden GameChanging AdWords Features Part Auction Insights GIPHY Capture The Neural Network Zoo Simple selectors facebookincubatorcreatereactapp Clean install ubuntu cannot connect to wifi using NetworkManager but nmtui works Hans Zimmer Interstellar Main Theme Piano Version Sheet Music Service Workers an Introduction JavaScript Promises an Introduction Larnaque des flammes jumelles quand le New Age dforme lAmour au profit de la Matrice Game of Thrones Main Theme Piano Version Sheet Music Building a Shop with SubSecond Page Loads LessonsLearned Guide de la consocollab Using npm packages in Rails Radar The Tau Manifesto Crez votre propre FPS en WebGL Accueil Jobset Recevez des offres demploi TypeScript vs ES vs ES VizEat Book immersive food events cooking classes food tours dinners brunch private parties VizEat FOSS Heartbeat analyses the health of a community of contributors CodePen is a social development environment for frontend designers and developers A collection of free books for developers Dix pistes pour dresser sa crativit la me ne va pas du tout vous tonner Amour vrai signes qui ne trompent pas Embedding projector visualization of highdimensional data The Need for Speed Pourquoi les femmes ont dsert linformatique dans les s alertsysmartnews Zenkit A beautiful way to organize JavaScript Geocoding Service Vuforia Unity Android Tutorial Your First AR App in minutes railswebpacker Hallelujah Leonard Cohen Piano Tutorial Synthesia Wouter van Wijhe This content is part of the seriesThe busy JavaScript developers guide to ECMAScript Part La Permanence Espace de travail Paris SketchAR start drawing easilyusing augmented reality Ready to try JavaScript Communiquez autrement Eschultsusefulstuff Pitchbot Google Maps now shows parking availability in metro areas PROJECTS INSAs GIFITI VIEWER User Defined Targets TouchTag Android Graffiti App Product Roadmap Builder by ProdPad Color Hunt How To Install the Anaconda Python Distribution on Ubuntu Get your app featured on the first smartphone with Project Tango from Lenovo Graffiti goes virtual with augmented reality app LZRTAG Whats the difference between RFID NFC and BLE ParkingSpot Immatriculation API com Chercher des plaques dimmatriculation franaises Blog Inspiration for Search UI Effects Demo Codrops reMarkable Enhancing Performance Sign up to create your first awe app for free emaiaxscriptcamrails Augmented Reality with HTML Quel est le taux de clic en fonction des positions dans Google cvenezianilewagonrailstemplates Numbers Facebook VS Snapchat combien rapporte un utilisateur Noun Project Learn React Native Meteor RESTful Many to Many Relationships in Rails YandexToloka httpsgithubcomytbryanhighlighting Steps Rails Front Color Scheme Rails Front Custom Fonts Rails Front Home page Daily inspiration collected from daily ui archive and beyond Hand picked updating daily La Rserve API Apiary Frederic Chopin Nocturne Op No BFlat Minor Piano hard The Flask MegaTutorial Part I Hello World Grid sukeeshJarvis Can you solve the chess problem which holds key to human consciousness Does Your Boss Have Emotional Intelligence Here Are Ways to Truly Know iParking An Intelligent Indoor LocationBased Smartphone Parking Service One account All of Google One account All of Google Botify meetup Configure Cloudflare and Heroku over HTTPS Cloudflare Support Omniauth callback not firing returns failure with invalid credentials Data Science Summer School Website Domain StatsAnalysisRanking And Seo Report Website Domain StatsAnalysisRanking And Seo Report Geolocation API Specification Build an app with Rails and React The backend Weekend hack project with paired programming Interactive Dynamic ForceDirected Graphs withD Android Things Communicating with Bluetooth Low Energy devices Nous sommes comet la nouvelle manire de travailler en techdata Material Components for Android Michael Nyman The Heart Asks Pleasure First Piano Tutorial by PlutaX Synthesia reinventing organization Srendipit Statistical Significance in Marketing CAC Champagne Font Free by American Greetings Corporation Internet Noise Philippe Boisnard mtaphysique des flux Maurice Benayoun React Native Architecture Explained Want A BetterPerforming Brain Start By Cutting Out Stress la clef daccs la plateforme Goportail utilise pour paramtrer le SDK Todo bot Hubsy Hubsy Rpublique Caf Coworking I Am The Yeggman Reacts JSX vs Vues templates a showdown on the frontend Clientside vs serverside rendering why its not all black andwhite Google Fonts File README Reducing Dimensionality from Dimensionality Reduction Techniques Learn to code and help nonprofits Typeform requires the use of a larger screen area please use a nonmobile device to access your account Root Cause Analysis Points to be effective FrenchWeb Jobs ES was Released and here are its Main New Features HippoARreactnativearkit How to make your own ARKit app in minutes using ReactNative Realtime with React and Rails Growbot Standuply FaceMatch Niles Revise Bot Quizdom Hyphen ProductPlan ReviewQ mudarParkCatcher The Best Parking Apps Youve Never Heard Of and Why You Havent How to migrate your Heroku Postgres database to Amazon RDS Sketchboardio How to customise devise to store user role information in session railsjbuilder En cours Club Open Innovation ParisCo Secure your modern Web App with JWT strapistrapi Aide Contacts React Nanodegree Les hommes phobiques de lengagement Sexisme chez Google Cest biologique les femmes ne sont pas faites pour linformatique JavaScript Understanding the Weird Parts The First Hours JavaScript Reference How to create a Neural Network in JavaScript in only lines ofcode All the fundamental Reactjs concepts jammed into this single Mediumarticle Machine Learning for Humans Enqute comment les apps Figaro Lquipe ou Closer participent au pistage de millions de Franais A la Wild Code School tout est affaire de motivation et de persvrance AngularJS CSS jQuery Mthode agile Programmation informatique Wordpress Javascript SYMFONY Dveloppement mobile HTML Prestashop SQL Webstart Lcole des mtiers metier du web Formation Developpement web mobile Dveloppeur Web en mois Five Tribes of Machine Learning Login du client Google ARCore Augmented reality at Android scale Hacker News GPS BUSINESS NEWS Google ARCore gives Android users augmented reality without Tango faons daugmenter la dopamine dans votre cerveau Tajine au poulet pruneaux et amandes Your Brain is YourPhone The Dark Knight Main Theme Piano Version Sheet Music Deadly Sins of Innovation Maitak Dveloppeur intgrateur en ralisation dapplications web Dveloppeur dapplication mobile spcialisation iOS Tiramisu aux Oros Learning to Code Open Source DoctorWho Things Ive Learned Since Quitting My Job La formation continue du dveloppeur Le Groupe La Poste dformosomachinelearningmindmap Challenge Find the Missing Number Yoga minute minute pour faire le corbeau Types et variables du langage python SELL BARTER your SIDE PROJECTS How We Built Our React NativeApp Les applis franaises qui vous simplifieront la rentre Effective JavaScript Specific Ways to Harness the Power of JavaScript Effective Software Development Series st Edition Comment nous avons lanc notre startup sans dveloppeur Blog Mlanome de Stade IV valuation de votre capacit dadaptation personnelle au changement JavaScript Des places de parking bientt rserves aux covoitureurs en ledeFrance NoSoft show at bpaste Location Appartement m Courbevoie Gambetta Location Appartement m Courbevoie Bcon Location Appartement m Courbevoie Marceau Rpublique Location Appartement m Courbevoie Htel de Ville Location Appartement m Courbevoie Bcon Location appartement pices m Colombes Location appartement pices m Colombes Location appartement pices m BoisColombes Location appartement pices m BoisColombes Billiondollar startup Letgo is becoming the goto app for selling your stuff heres how it works Catalog Dr Anna Clark on Twitter Eschultsreactgiphy lewagonstaticairbnbredux lewagonchatredux constructor vs componentWillMount vs componentDidMount La blockchain ouvre le champ des possibles pour la smart city Samsung Connect Auto un dongleOBD II doubl dun hot spot GWiFi lewagonblograilsredux lewagongarageredux lewagonblogredux lewagonstaticairbnbredux Offre nCXBW Offre n Offre n Dveloppeurse Fullstack JavaScript HF Offre nCWRM Dveloppeur FullStack startups possibles CDI Going Beyond ServerSide Rendering Book pieresparre lewagonreactboilerplate lewagonreduxboilerplate lewagonreduxrouterboilerplate Location Appartement m AsniressurSeine VoltaireGrsillons Location Appartement m Asnieres sur Seine Location Appartement m AsniressurSeine Location Appartement m Asnieres sur Seine Hauts dAsniresArgenteuil Location Appartement m AsnieressurSeine CentreVoltaire SkyCube The First Satellite Launched by You Natural Language Processing WC Link Checker Un titre JavaScript that scales Sortable Processing Raw Text Augmented Reality SDK Comparison Open Source Satellite Initiative KeyboardShortcuts Community Help Wiki LearnGetting Started with the GeoLocation API elabspundit savonrbsavon Basic Building Blocks Pure Data Pd Community Site Lets Make a Map How to Play Skyfall by Adele Piano Tutorial and Sheet Music Vuforia Augmented Reality Linking interne les stratgies performantes Sublime Text Useful Shortcuts How can I tag and chunk French text using NLTK and Python Become an MIT Technology Review Insider for continuous indepth analysis and unparalleled perspective Interactive graph visualisation A Good User Interface SuperAgent Rubular Hacker News Font Awesome Making Your App LocationAware Can I use Support tables for HTML CSS etc Why Business Plans Dont Get Funded Google Algorithm Change History Analyzing site content with GAS JSLint The JavaScript Code Quality Tool Creative Button Styles Modern and subtle styles effects for buttons hover and click Numba vs Cython Take Focus node explorer with djs ElasticSearch a getting started tutorial Rails tojson or asjson Wait But Why Home The exceptionally handsome dashboard framework Mashape Mashape The Circle SyntheticEvent Snazzy Maps Free Styles for Google Maps Stereotype threat PURE CSS ANIMATED TOGGLES CodePen Up For Grabs AZERTY Jobs Emploi StartUp Version mobile Free Fonts Legit Free Quality Font Squirrel Redis News SEO Reporting with Google Tag Manager Mapping it out APIs for locationbased apps Button Switch Google CodeProject For those who code JWTIO JavaScript Event KeyCodes For a Good Strftime Arrayprototypeentries MDiMarco Angular drag drop with HTML Deal API Using geolocation Predicting CTR with online machine learning WIRED Document Object Model DOM neojcontribspatial DragandDrop with jQuery Your Essential Guide Python Programming Tutorials Setting Up Sublime Text for Full Stack Python Development Custom Interactive Maps With the Google Maps API Simple form array text input uiGradients Beautiful colored gradients Tetris Theme Korobeiniki Piano Tutorial Synthesia Real time GPS Tracker on JUST HTML JS and Google Maps to be run on a handphone Is it possible Majestic Moteur de recherche marketing et outil SEO Backlink Checker Clearbit Pony Foo JavaScript consulting modularity frontend architecture performance and more Authored by Nicols Bevacqua Coolors HOOK SCRIPTS Product Hunt API Documentation Ralisez votre premier jeu vido avec Unity Le travail sur lego Serge Carfantan alexreisnergeocoder Learn the impact of duplicate URLs Useful Shortcuts for a Faster Workflow in Sublime Text A Guide to Testing Rails Applications Ruby on Rails Guides Burning Man Galleries The Imperial March Star Wars Piano Tutorial Synthesia Tech News Analysis Wall Street Journal SMS Receive FreeTemporary and Disposable Numbers HEBREW for Beginners The BEST of TEACHING Myself HEBREW Complete Language COURSE mes Le Centre de Flottaison acrogenesisowlcarouselrails Apiary Platform for API Design Development Documentation Initiation la clef de sol jeu de lecture de note Position of OBD II ports Opel Corsa D Interpreting AB Test using Python ChihJen Lins recent papers munkres Adagio In D Minor John Murphy Piano Tutorial Synthesia Mapping with D Camera Models and Augmented Reality Book googlegoogleauthlibraryruby Idriss Aberkane CodePen Map marker CSS only Recurse Center ECMAScript New Features Overview Comparison Alla Turca Turkish March Sonata No Wolfgang Amadeus Mozart Piano Tutorial Synthesia How To Track Your AdWords Competitors Over Time Using Auction Insights Using OAuth for Server to Server Applications Building an InstagramLike App with Parse and Swift GitHub public key authentication What is ARToolKit The Verge Optimization bakeoff Progressive Web Apps Escaping Tabs Without Losing Our Soul Game of Thrones episode chapter coverage Mining Twitter Data with Python and JS Part Geolocation and Interactive Maps How to point naked domain and www to the same Heroku app Service Worker API Home Developers Guide What TheFlexBox ECMAScript Tutorial Neoj Loading JSON documents with Cypher Payer son stationnement https www grafikart fr tutoriels cordova ionic framework http www colorhunt co https jakevdp github io blog out of core dataframes in python https blog dominodatalab com ab testing with hierarchical models in python https developer mozilla org en US docs Learn Gettingstartedwiththeweb http lewagon github io ui components tabs https github com shakacode reactonrails http alumni lewagon org https www youtube com watch vsleZ hzrtRY https ponyfoo com articles es promises in depth http nbviewer jupyter org github ptwobrussell Mining the Social Web nd Edition tree master ipynb http blog fouadhamdi com introduction a nltk https market mashape com imagesearcher camfind https qbox io blog building an elasticsearch index with python http ban jo discovery http www mikesboyle com post python nltk wtf chapter notes on things that https www pubnub com blog google maps geolocation tracking in realtime with javascript https blog monkeylearn com the definitive guide to natural language processing https github com lewagon rails stylesheets http adhdtechies com productivity for adhd programmers http www equityowl com https reactforbeginners com https www softcover io books fdbf learnenoughtexteditor https www mapbox com studio welcome https developer wordpress com calypso https medium com readme mic why proxima nova is everywhere ca https www paybyphone com news paybyphone adds nfc http www programmableweb com news google wants to fund app developers project tango phone https www youtube com watch vCHVxTGDWs https dribbble com shots Maps UI Kit https www lesechos fr idees debats cercle cercle economie collaborative ou economie du partage cherchez lerreur phpXtorAD https backchannel com gifeffc http www gouvernement fr partage rapport de pascal terrasse sur le developpement de l economie collaborative http www frenchweb fr onepark leve millions deuros et vise parkings en europe https www metavision com https github com reactjs redux blob master docs recipes ServerRendering md http magazine ouishare net fr leconomie collaborative cest fini https locomotiv co https medium com adrianli setting up sublime text for reactjs bfbaceba https www anticafe eu republique https www mindmeister com fr account login product https mobiforge com design development service worker toolkits and libraries https developers google com web fundamentals engage and retain web app manifest http www w org Style css selectors updates WD css selectors fr htmlselectors https gorails com setup ubuntu https cloud google com speech https codelabs developers google com codelabs offline http www youtube com watch vGtUQzTCpNA https blog rstudio org feather https tools houses com agenda https www lewagon com fr blog tuto setup metatags rails https www youtube com watch vHk KDZzQ https sublimetutor com https github com lewagon sinatra http xoxco com projects code tagsinput http andrewhfarmer com server side render https github com lewagon rails templates https github com livecode livecode https www youtube com watch vSWEtsrlezA https www picodash com https www youtube com watch vHhqETxuUI https dribbble com shots Socialico Free font https www quora com Will Elixir Phoenix destroy Ruby on Rails https www youtube com watch vnEacvvjXjw http www thegreatcodeadventure com building a super simple rails api json api edition https www ecma international org ecma index html https www chargify com blog the stages of a saas company https github com d d force https www sandimetz com http guides rubyonrails org actioncableoverview html http ccoenraets github io es tutorial setup babel https vibe work http www theguardian com books jul heroes of the frontier dave eggers review utopianism http stackoverflow com questions sudo npm command not found https paris numa co coworking et communautes http jessewolgamott com blog the one with a json api login using devise https www youtube com watch vnSLqQIUY http www tdah adulte org EntretiendiagnostiquepourleTDAHAdulteDIVAFRANCAIS pdf https hrdag org tech notes clustering and solving the right problem html http jqueryui com checkboxradio no icons https stephengrider github io JSPlaygrounds http www ifocop fr formations metiers web digital formation developpeur full stack js https github com carlsednaoui ouicards https cloud google com pubsub docs overview https tryolabs com blog python elasticsearch first steps https medium com dev channel why progressive web apps vs native is the wrong question to ask fbaddcbb https www awwwards com social networks for developers html https www semrush com blog hidden game changing adwords features part auction insights https giphy com apps giphycapture http www asimovinstitute org neural network zoo https developer mozilla org en US docs Learn CSS IntroductiontoCSS Simpleselectors https github com facebookincubator create react app https askubuntu com questions clean install ubuntu cannot connect to wifi using networkmanager but nmtu https www youtube com watch vyhphKU https developers google com web fundamentals getting started primers service workers https developers google com web fundamentals getting started primers promises http revolutionvibratoire fr larnaque des flammes jumelles quand le new age deforme lamour au profit de la matrice https www youtube com watch vyZGBxiNPuk https medium baqend com building a shop with sub second page loads lessons learned bbbeed http guide consocollaborative com projects categorymobilite http ricostacruz com til npm in rails https www onradar com http tauday com tau manifesto https openclassrooms com courses creez votre propre fps en webgl http jobset io https www excella com insights typescript vs es vs es https www vizeat com https github com sarahsharp foss heartbeat http codepen io https devfreebooks github io https leblournaldechristineberrou com dix pistes pour dresser sa creativite la eme ne va pas du tout vous etonner http www conscience et eveil spirituel com amour vrai signes trompent html http projector tensorflow org https lectures quantecon org py needforspeed html https start lesechos fr rejoindre une entreprise actu recrutement pourquoi les femmes ont deserte l informatique dans les s php http www alertsy ai https zenkit com https javascript com https developers google com maps documentation javascript geocoding https www youtube com watch vHnjbTytHHU https github com rails webpacker https www youtube com watch vZeMYljgAPSU http www ibm com developerworks library wa ecmascript neward p index html http www la permanence com about http sketchar tech https www javascript com http www kindo fr https github com Eschults usefulstuff https www producthunt com posts pitchbot http www digitaltrends com mobile google maps parking availability android app http www theheavyprojects com https itunes apple com us app insas gif iti viewer id mt https library vuforia com articles Training User Defined Targets Guide https www youtube com watch vzyQCrSdGD https www producthunt com posts product roadmap builder by prodpad http colorhunt co c https www digitalocean com community tutorials how to install the anaconda python distribution on ubuntu https android developers googleblog com get your app featured on first html http newatlas com lzrtag augmented reality graffiti https www youtube com watch vatphSqrvAc https marvelapp com he screen http www immatriculationapi com https www sqlprep com blog https tympanus net Development SearchUIEffects index html https www producthunt com posts remarkable http pandas docs github io pandas docs travis enhancingperf html highlightdataframe https kd awe io live edit objects https github com emaiax scriptcam rails http www linuxjournal com article page http www mathiasp fr blog seo quel est le taux de clic en fonction des positions dans google https github com cveneziani lewagon rails templates http www frenchweb fr numbers facebook vs snapchat combien rapporte un utilisateur https thenounproject com http learn handlebarlabs com courses http ngauthier com restful many to many relationships in rails html https toloka yandex com fr https github com ytbryan highlighting https www producthunt com posts steps https vimeo com https vimeo com https vimeo com http collectui com challenges location tracker http docs lareserveapi apiary io reference booking form create a booking https www youtube com watch vkzLGcNwDJW https blog miguelgrinberg com post the flask mega tutorial part i hello world https tympanus net codrops cssreference grid https github com sukeesh Jarvis http www telegraph co uk science can solve chess problem holds key human consciousness http www inc com marcel schwantes ways to tell if your boss is really emotionally intelligent and not just fakin html https www ncbi nlm nih gov pmc articles PMC https docs google com presentation d bzRbJNFoXDxMCEeKgmEpY SEewRVRVknGdRc editslideid ga https docs google com document d lAgXpYwgthhIbdTySPNeeMqzrJUXzSPfgSA cO editheadingh ghcuyc https docs google com document d WQzfnxVPJFaYJazetgjBVnTIJCWKzvaabxws edit uspembedfacebookuspembedfacebookuspembedfacebookuspembedfacebook https support cloudflare com hc en us articles Configure Cloudflare and Heroku over HTTPS http stackoverflow com questions omniauth callback not firing returns failure with invalid credentials https portail polytechnique edu datascience en data science summer school http statstool com http statstool com http dev w org geo api spec source html https groundberry github io development build an app with rails and react the back end html https www reddit com r reactjs comments vkpx weekendhackprojectwithpairedprogramming https medium com ninjaconcept interactive dynamic force directed graphs with d dacd http nilhcem com android things bluetooth low energy https www hellocomet co https material io components android catalog https www youtube com watch vvHXhXHQ https www google fr search qreinventingorganizationclientms android orange frprmdisvnsourcelnmstbmischsaXvedahUKEwjByaGIbUAhWHzRoKHeSiDDMQAUICSgBbiwbihtbmischqreinventingorganizationopaleimgrcnjJgghZYFpncM http fr m wikipedia org wiki SCArendipitCA http www optimove com learning center statistical significance in marketing https www fontsquirrel com fonts CAC Champagne http makeinternetnoise com index html http media digitalarti com fr blog digitalartimag philippeboisnardmetaphysiquedesflux https www google fr search kgmid m qgchlen FRkgsfecffeecqMauriceBenayounshndlsourcesh x kpentrypointsh x kp https www logicroom co react native architecture explained http tools seochat com tools page link analyzer seo imageverifySXEDHtimehshabbdgotoolurlwww concours oscaro comdisplaybothrelsubmitShowLinks https www forbes com sites quora want a better performing brain start by cutting out stress https geoservices ign fr documentation utilisationweb sdk htmlconfiguration dynamique https app todobot io list edeeeaaf https www hubsy fr shops https www hubsy fr shops republique https freethoughtblogs com recursivity https medium freecodecamp org reacts jsx vs vue s templates a showdown on the front end ba https medium freecodecamp org what exactly is client side rendering and hows it different from server side rendering bdcbd https fonts google com http www rubydoc info gems faraday https medium com towards data science reducing dimensionality from dimensionality reduction techniques faecdfe https www freecodecamp org challenges headline with the h element https admin typeform com workspaces utmcampaignrCYstAutmsourcetypeform com Basicutmmediumtypeformutmcontenttypeform thankyoubuttonutmtermEN https www youtube com watch vCTRcrEpLo https www frenchweb jobs https hackernoon com es was released and here are its main new features eecadf https github com HippoAR react native arkit https medium com HippoAR how to make your own arkit app in minutes using react native dceac https blog codeship com realtime with react and rails https par kin slack com apps ADVEEN growbot https par kin slack com apps AVK standuply https par kin slack com apps ABPBV facematch https par kin slack com apps ADRGED niles https par kin slack com apps ATDMZ revise bot https par kin slack com apps AUAEFHP quizdom https par kin slack com apps AHPJHZ hyphen https app productplan com pjaEgG https par kin slack com apps AJSBH reviewq https github com mudar ParkCatcher wiki API https features slashdot org story the best parking apps youve never heard of and why you havent https www lewagon com blog how to migrate your heroku postgres database to amazon rds https sketchboard me jAzwZBtjQg https stackoverflow com questions how to customise devise to store user role information in session https github com rails jbuilder blob master CONTRIBUTING md http clubopeninnovation fr category en cours https www zuehlke com blog en secure your modern web app with jwt https github com strapi strapi blob master ROADMAP md https www ter sncf com aquitaine contacts https www udacity com course react nanodegree nd http sexes blogs liberation fr les hommes phobiques de lengagement http www parismatch com Actu International Sexisme chez Google C est biologique les femmes ne sont pas faites pour l informatique https www youtube com watch vBvZvc Ts https www codecademy com articles bwa javascript reference https medium freecodecamp org how to create a neural network in javascript in only lines of code dafcd https medium freecodecamp org all the fundamental react js concepts jammed into this single medium article cfbeac https medium com machine learning for humans why machine learning matters fafdf https www numerama com cdn ampproject org c www numerama com politique enquete comment les apps figaro lequipe ou closer participent au pistage de millions de francais html amp https wildcodeschool fr formation developpeur en mois https formation meteojob com training search trainings TREwtMTctTkZfTmVdGZvcmhdGlvbg http ecole webstart com developpement web mobile https formation meteojob com training search trainings TMdBLTFfMdB https kevinbinz com ml five tribes http www smartbox com fr customer beneficiary activity id voucher cbdafddaaaaedbabfacfaaecaeebc https www google com gferdcreiUAekWaOFMfUXtazhMgP https news ycombinator com item id http www gpsbusinessnews com Location Based Servicesr html https www theverge com cdn ampproject org c s www theverge com platform amp google arcore augmented reality platform announce release pixel samsung http www espritsciencemetaphysiques com augmenter la dopamine html http www cuisineaz com recettes tajine au poulet pruneaux et amandes aspx https howwegettonext com your brain is your phone abdfef https www youtube com watch vnKluYTub https marketoonist com deadly sins of innovation html https www dieti natura com maitake html https candidat pole emploi fr formations detail https candidat pole emploi fr formations detail http www g com tiramisu aux oreos r htm https codeburst io open source doctor who aeabd https www thriveglobal com stories things i ve learned since quitting my job http www jdecool fr blog formation continue du developpeur veille html https www laposte fr particulier outils trouver un bureau de poste bureau detail paris debussy A https github com dformoso machine learning mindmap https discuss codecademy com t challenge find the missing number https www youtube com watch vfmWRRIDQFLE http www xavierdupre fr app teachpyx helpsphinx clang types html http borderline biz https medium com engineering housing how we built our react native app aac https letsgofrance fr talents articles les applis francaises qui vous simplifieront la rentree https www amazon com Effective JavaScript Specific Software Development dp https start lesechos fr entreprendre temoignages entrepreneurs comment nous avons lance notre startup sans developpeur php https www sqlprep com blog http www aimatmelanoma net fr aim for answers stades du melanome melanome de stade iv html https tdahadulte com evaluation de votre capacite dadaptation personnelle au changement https www pluralsight com paths javascript aidaBamAAASoidpromoutmcampaignJavaScript SkillScore FacebookutmcontentutmmediumSocialMedia PaidutmsourceFacebookutmterm http www huffingtonpost fr des places de parking bientot reservees aux covoitureurs en ile de francea http www nosoft io https bpaste net show cabaa http www pap fr annonce locations appartement particulier levallois perret g pieces a partir de chambres rdialogcarte http www pap fr annonce locations appartement levallois perret ggg pieces a partir de chambres r http www pap fr annonce locations appartement levallois perret ggg pieces a partir de chambres r http www pap fr annonce locations appartement levallois perret ggg pieces a partir de chambres r http www pap fr annonce locations appartement levallois perret ggg pieces a partir de chambres r http www pap fr annonce immobilier location appartement levallois perret ggg pieces a partir de chambres r http www pap fr annonce immobilier location appartement levallois perret ggg pieces a partir de chambres r http www pap fr annonce immobilier location appartement levallois perret ggg pieces a partir de chambres r http www pap fr annonce immobilier location appartement levallois perret ggg pieces a partir de chambres r http www seloger com annonces locations appartement courbevoie gambetta htm http www seloger com annonces locations appartement courbevoie becon htm http www seloger com annonces locations appartement courbevoie marceau republique htm http www seloger com annonces locations appartement courbevoie becon htm ciidttidtypebienLISTING LISTpgnaturebiennbchambresnbpiecestriddtcrea http www seloger com annonces locations appartement courbevoie hotel de ville htm http www seloger com annonces locations appartement courbevoie becon htm http www explorimmo com annonce html http www explorimmo com annonce html http www explorimmo com annonce html http www explorimmo com annonce html http www businessinsider fr us letgo app buy sell used items online https www codecademy com programs aceaecaabc items cdfcacaaf https twitter com DrAnnaClark status https github com Eschults react giphy https github com lewagon static airbnb redux https github com lewagon chat redux https discuss reactjs org t constructor vs componentwillmount vs componentdidmount https github com lewagon react redux challenges tree master React in Rails Rails Chat http www lemonde fr smart cities article la blockchain ouvre le champ des possibles pour la smart city html https www nextinpact com news samsung connect auto dongle obd ii double dun hot spot gwi fi htm https github com lewagon blog rails redux https github com lewagon garage redux https github com lewagon blog redux https github com lewagon static airbnb redux https github com lewagon react redux challenges https candidat pole emploi fr offres recherche detail CXBW https candidat pole emploi fr offres recherche detail https candidat pole emploi fr offres recherche detail https fr linkedin com jobs view dCAveloppeurse fullstack javascript h f at mobiskill expert en recrutement tech https candidat pole emploi fr offres recherche detail CWRM https fr linkedin com jobs view dCAveloppeur full stack startups possibles cdi at ignition program https console cloud google com apis api gmail googleapis com overview projectparking spot https github com lewagon react redux challenges tree master Tooling Setup https www safaribooksonline com library view building isomorphic javascript ch html http pieresparre fr https github com lewagon react boilerplate https github com lewagon redux boilerplate https github com lewagon redux router boilerplate https www pap fr annonces appartement courbevoie r https www pap fr annonces appartement courbevoie becon r https www pap fr annonces appartement clichy r https www pap fr annonces appartement levallois perret r http www seloger com annonces locations appartement asnieres sur seine voltaire gresillons htm http www seloger com annonces locations appartement asnieres sur seine htm http www seloger com annonces locations appartement asnieres sur seine htm http www seloger com annonces locations appartement asnieres sur seine hauts d asnieres argenteuil htm http www seloger com annonces locations appartement asnieres sur seine centre voltaire htm https www kickstarter com projects skycube the first satellite launched by you https research google com pubs NaturalLanguageProcessing html http validator w org checklink http desordre net http typescriptlang org https jqueryui com sortable portlets http www nltk org book ch html http www nltk org book ch html http socialcompare com en comparison augmented reality sdks http opensat cc about html https help ubuntu com community KeyboardShortcuts http blog teamtreehouse com getting started with the geolocation api https github com elabs pundit https github com savonrb savon https www dashingdjs com basic building blocks https puredata info http bost ocks org mike map http www youtube com watch vkUpWPFmI http www vuforia com http www htitipi com blog linking interne html https gist github com eteanga http stackoverflow com questions how can i tag and chunk french text using nltk and python https www technologyreview com http bl ocks org benzguo http stackoverflow com questions interactive graph visualisation http juliemirande com astuces pour optimiser votre referencement avec pinterest https goodui org https visionmedia github io superagent http rubular com https news ycombinator com http fontawesome io https developer android com training location index html http caniuse com searchSameSite https www caycon com why business plans dont get funded php https moz com google algorithm change http ramblings mcpher com Home excelquirks gassites gastags http www jslint com http tympanus net Development CreativeButtons https jakevdp github io blog numba vs cython take http ramblings mcpher com Home excelquirks gassites dnodefocus http joelabrahamsson com elasticsearch http jonathanjulian com rails tojson or asjson https waitbutwhy com http xoxco com projects code tagsinput example html http www poodr com http dashing io https github com Mashape http www goodreads com work bestbook the circle https facebook github io react docs events html https snazzymaps com https en wikipedia org wiki Stereotypethreat http codepen io soulrider full qhEzf http up for grabs net http azertyjobs com https www fontsquirrel com https redis io http www lunametrics com blog seo reporting google tag manager https www developereconomics com mapping apis location based apps http codepen io margarida pen FJeoE https www google fr webhp sourceidchrome instantionespvieUTF qconsultantSEOfabriquedunet https www codeproject com cat https jwt io http keycode info http www foragoodstrftime com https developer mozilla org en US docs Web JavaScript Reference GlobalObjects Array entries http work markmarkoh com http marceljuenemann github io angular drag and drop lists demo nested http partner api groupon com help deal api https developer mozilla org en US docs Web API Geolocation Usinggeolocation https mlwave com predicting click through rates with online machine learning https www wired com https developer mozilla org en US docs Web API DocumentObjectModel https github com neoj contrib spatial http www elated com articles drag and drop with jquery your essential guide https pythonprogramming net https realpython com blog python setting up sublime text for full stack python development https code tutsplus com courses custom interactive maps with the google maps api http railsguides net simple form array text input http uigradients com VirginAmerica http www youtube com watch vNuhuzJAibNI https stackoverflow com questions real time gps tracker on just html js and google maps to be run on a handphone https fr majestic com https clearbit com https ponyfoo com https coolors co fe dbba fefc fffe ffeee https docs npmjs com misc scripts https api producthunt com v docs https openclassrooms com courses realisez votre premier jeu video avec unity http www philosophie spiritualite com cours sujet htm https github com alexreisner geocoder https support google com webmasters answer https webdesign tutsplus com tutorials useful shortcuts for a faster workflow in sublime text cms http guides rubyonrails org testing html http galleries burningman org plugins burningman pages about php http www youtube com watch vHz FmmjmY https www wsj com news technology https smsreceivefree com https www youtube com watch vdEPFYGXJctg http www meiso fr https github com acrogenesis owlcarousel rails https apiary io http www apprendrelesolfege com ex clef de sol initiation http www outilsobdfacile com location plug connector obd Opel corsa d http okomestudio net biboroku p http www csie ntu edu tw cjlin papers html https pypi python org pypi munkres https www youtube com watch vab diOUZU https maptimeboston github io d maptime https www safaribooksonline com library view programming computer vision ch html https github com google google auth library ruby https fr wikipedia org wiki IdrissAberkane http codepen io andreasstorm full ClguF https www recurse com http es features org PromiseUsage https www youtube com watch vKdSKNBvSo http searchengineland com track adwords competitors time using auction insights https developers google com identity protocols OAuthServiceAccount http www appcoda com instagram app parse swift http sebastien saunier me blog github public key authentication html http artoolkit org https www theverge com https people duke edu ccc sta OptimizationBakeoff html https infrequently org progressive apps escaping tabs without losing our soul http joeltronics github io got book show bookshow html https marcobonzanini com mining twitter data with python and js part geolocation and interactive maps http webmasters stackexchange com questions how to point naked domain and www to the same heroku app https developer mozilla org en US docs Web API ServiceWorkerAPI http reactkungfu com https developers google com maps documentation geocoding intro https flexbox io http ccoenraets github io es tutorial http www markhneedham com blog neoj loading json documents with cypher https www paris fr services et infos pratiques deplacements et stationnement stationnement payer son stationnement Tutoriel Vido Apache CordovaIonic Framework Comments Conclusion Getting started with the Web Le Wagon Berlin FINAL NOTES Nocturne Opus No Frederic Chopin Piano Tutorial Synthesia Leveraging Promiseall and Promiserace CloudSight Build an Elasticsearch Index with PythonMachine Learning Series Part Python NLTK WTF Chapter Notes on things that dont work right Realtime Google Maps Geolocation Tracking with JavaScript lewagonrailsstylesheets ADHDTechies Trade equity in your startup or idea for professional services Learn Enough Text Editor to Be Dangerous Michael Hartl The New WordPresscom Why Proxima Nova Is Everywhere PayByPhone Adds NFC in San Fran Google Wants to Fund App Developers for Project Tango Phone Project Tango Virtual and Augmented Reality for Mobile Phones Ubiquity Dev Summit Maps UI Kit conomie collaborative ou conomie du partage cherchez lerreur Our Favorite Wireless Headphones From Bose to Beats Rapport de Pascal Terrasse sur le dveloppement de lconomie collaborative OnePark lve millions deuros et vise parkings en Europe Server Rendering Lconomie collaborative cest fini Locomotiv Setting Up Sublime Text for ReactJS Connexion Service worker toolkits and libraries The Web App Manifest Module CSS Slecteurs WC Setup Ruby On Rails on Ubuntu Xenial Xerus Speech API Features FantaisieImpromptu Opus Frederic Chopin Piano Tutorial Synthesia Feather A Fast OnDisk Format for Data Frames for R and Python powered by Apache Arrow Le setup des Meta Tags dans Rails Moonlight Sonata Complete Piano Tutorial Synthesia Sublime Tutor Sinatra jQuery Tags Input Should I use React ServerSide Rendering Testing LiveCode Community Edition RailsConf Turbolinks I Cant Believe Its Not Native by Sam Stephenson ALREADY SUBSCRIBED Lacrimosa Wolfgang Amadeus Mozart Piano Tutorial Synthesia Socialico Free font Comptine dun autre t Amlie Piano Tutorial Synthesia Building a Super Simple Rails API JSON API Edition GCopyright Software License The Stages Of A SaaS Company When To Scale For Success dforce Sandi Metz Guidesrubyonrailsorg Setting Up a Babel Project Team behind Vibe The Circle by Dave Eggers review WARNING edit Coworking The One With a JSON API Login Using Devise Kundalini Awakening the Shakti Within Clustering and Solving the Right Problem Checkboxradio Ouicards Fancy Schmancy Flashcards What is Google Cloud PubSub Code Tips Tricks and Freebies Delivered Monthly Why Progressive Web Apps vs native is the wrong question to ask Social Networks for Developers Hidden GameChanging AdWords Features Part Auction Insights GIPHY Capture The Neural Network Zoo Simple selectors Create React App Clean install ubuntu cannot connect to wifi using NetworkManager but nmtui works Hans Zimmer Interstellar Main Theme Piano Version Sheet Music Service Workers an Introduction JavaScript Promises an Introduction Oops That page cant be found Game of Thrones Main Theme Piano Version Sheet Music Building a Shop with SubSecond Page Loads Lessons Learned Using npm packages in Rails The Tau Manifesto Crez votre propre FPS en WebGL Comment fonctionne Jobset TypeScript vs ES vs ES Discover authentic food experiences in countries fossheartbeat CodePen A collection of free books for developers Sabonner au blog via courriel Post navigation The Need for Speed Pourquoi les femmes ont dsert linformatique dans les s The Secrets of Productivity Zen JavaScript Geocoding Service Vuforia Unity Android Tutorial Your First AR App in minutes Webpacker Hallelujah Leonard Cohen Piano Tutorial Synthesia Wouter van Wijhe New objects and types in the standard library usefulstuff Pitchbot Google Maps now shows parking availability in metro areas TouchTag Android Graffiti App Product Roadmap Builder by ProdPad Report a Bug Developers Blog Graffiti goes virtual with augmented reality app LZRTAG Whats the difference between RFID NFC and BLE Contacteznous pour un compte dessai gratuit Blog Inspiration for Search UI Effects reMarkable Enhancing Performance Sign up to create your first awe app for free ScriptcamRails Augmented Reality with HTML Quel est le taux de clic en fonction des positions dans Google Testing Numbers Facebook VS Snapchat combien rapporte un utilisateur Learn React Native Meteor RESTful Many to Many Relationships in Rails Highlighting Steps Rails Front Color Scheme Rails Front Custom Fonts Rails Front Home page Daily inspiration collected from daily ui archive and beyond Hand picked updating daily Frederic Chopin Nocturne Op No BFlat Minor Piano hard Categories Jarvis Can you solve the chess problem which holds key to human consciousness Does Your Boss Have Emotional Intelligence Here Are Ways to Truly Know iParking An Intelligent Indoor LocationBased Smartphone Parking Service One account All of Google Cloudflare support Omniauth callback not firing returns failure with invalid credentials Data Science Summer School Website Domain StatsAnalysisRanking And Seo Report Website Domain StatsAnalysisRanking And Seo Report Geolocation API Specification Build an app with Rails and React The backend whoa there pardner Interactive Dynamic ForceDirected Graphs with D Android Things Communicating with Bluetooth Low Energy devices We help freelancers and companies join forces to build the future of tech Components Michael Nyman The Heart Asks Pleasure First Piano Tutorial by PlutaX Synthesia Srendipit Forbidden Login to your account Internet Noise Suivez nous Follow us React Native Architecture Explained Want A BetterPerforming Brain Start By Cutting Out Stress Kit de dveloppement The page you were looking for doesnt exist Error Ray ID bbcf UTC Reacts JSX vs Vues templates a showdown on the front end Clientside vs serverside rendering why its not all black and white Faraday Reducing Dimensionality from Dimensionality Reduction Techniques Log in to Typeform Root Cause Analysis Points to be effective FrenchWeb Jobs ES was Released and here are its Main New Features reactnativearkit How to make an ARKit app in minutes using React Native Forbidden App Directory App Directory App Directory App Directory App Directory App Directory App Directory App Directory API Slashdot Top Deals How to migrate your Heroku Postgres database to Amazon RDS How to customise devise to store user role information in session Contributing to Jbuilder SAFRAN Environnement de simulation biomcaniq Secure your modern Web App with JWT ETA v Compte client Become a React Expert Les hommes phobiques de lengagement Sexisme chez Google Cest biologique les femmes ne sont pas faites pour linformatique JavaScript Understanding the Weird Parts The First Hours JavaScript Reference How to create a Neural Network in JavaScript in only lines of code All the fundamental Reactjs concepts jammed into this single Medium article Machine Learning for Humans Enqute comment les apps Figaro Lquipe ou Closer participent au pistage de millions de Franais Devenir dveloppeur en mois Dveloppeureuse de logiciel Le lancement Dveloppeur Web en mois Meta Google ARCore gives Android users augmented reality without Tango faons daugmenter la dopamine dans votre cerveau Tajine au poulet pruneaux et amandes Your Brain is Your Phone The Dark Knight Main Theme Piano Version Sheet Music Deadly Sins of Innovation Maitak Tiramisu aux Oros Learning to Code Open Source Doctor Who Things Ive Learned Since Quitting My Job PARIS DEBUSSY Machine Learning Mindmap Cheatsheet Yoga minute minute pour faire le corbeau Types et variables du langage python SELL BARTER your SIDE PROJECTS How We Built Our React Native App Les applis franaises qui vous simplifieront la rentre Effective JavaScript Specific Ways to Harness the Power of JavaScript Effective Software Development Series st Edition Comment nous avons lanc notre startup sans dveloppeur Blog Mlanome de Stade IV valuation de votre capacit dadaptation personnelle au changement JavaScript Des places de parking bientt rserves aux covoitureurs en ledeFrance NoSoft Location appartement LevalloisPerret pices partir de chambres page Location appartement LevalloisPerret Courbevoie AsniressurSeine pices partir de chambres Location appartement LevalloisPerret Courbevoie AsniressurSeine pices partir de chambres Location appartement LevalloisPerret Courbevoie AsniressurSeine pices partir de chambres Location appartement LevalloisPerret Courbevoie AsniressurSeine pices partir de chambres page Location appartement LevalloisPerret Courbevoie AsniressurSeine pices partir de chambres page Location appartement LevalloisPerret Courbevoie AsniressurSeine pices partir de chambres page Location appartement LevalloisPerret Courbevoie AsniressurSeine pices partir de chambres page Location appartement pices m Colombes Location appartement pices m Colombes Les vallees commerces gare les vallees Location appartement pices m BoisColombes Location appartement pices m BoisColombes Billiondollar startup Letgo is becoming the goto app for selling your stuff heres how it works Dr Anna Clark reactboilerplate reactboilerplate reduxboilerplate constructor vs componentWillMount vs componentDidMount La blockchain ouvre le champ des possibles pour la smart city Samsung Connect Auto un dongle OBD II doubl dun hot spot GWiFi lewagonblograilsredux reduxrouterboilerplate reduxrouterboilerplate reactboilerplate One account All of Google Summary reactboilerplate reduxboilerplate reduxrouterboilerplate Location appartement pices m Courbevoie Location Courbevoie Location Clichy Location appartement pices m LevalloisPerret And Finally Natural Language Processing Link Checker Why TypeScript Sortable Processing Raw Text Docutils System Messages Augmented Reality SDK Comparison KeyboardShortcuts License Savon Basic Building Blocks Pure Data Skyfall Piano Tutorial How to Play Adele A more powerful way to engage Linking interne les stratgies performantes How can I tag and chunk French text using NLTK and Python Force Editor PanZoom Interactive graph visualisation Coming soon A Good User Interface SuperAgent Rubular Font Awesome Why Business Plans Dont Get Funded Google Algorithm Change History Creative Button Styles Modern and subtle styles effects for buttons hover and click Comments More about Search Engines On Twitter Forbidden Dashing Mashape The Circle SyntheticEvent Stereotype threat PURE CSS ANIMATED TOGGLES I maintain a project Emploi Startup les meilleurs jobs sont sur AZERTY Jobs Login to your account Forbidden Button Switch Libraries for Token SigningVerification For a Good Strftime Arrayprototypeentries Animated line graph curtain approach Angular drag drop with HTML Deal API Using geolocation Around the web Document Object Model DOM Neoj Spatial DragandDrop with jQuery Your Essential Guide Comments Custom Interactive Maps With the Google Maps API Simple form array text input Tetris Theme Korobeiniki Piano Tutorial Synthesia Real time GPS Tracker on JUST HTML JS and Google Maps to be run on a handphone Is it possible Le moteur de recherche marketing Majestic est destin aux Join the Thousands of Companies Using Clearbit ponyfoocom How npm handles the scripts field Product Hunt Ralisez votre premier jeu vido avec Unity Geocoder Learn the impact of duplicate URLs Useful Shortcuts for a Faster Workflow in Sublime Text Guidesrubyonrailsorg The Imperial March Star Wars Piano Tutorial Synthesia SMS Receive Free HEBREW for Beginners The BEST of TEACHING Myself HEBREW Complete Language COURSE Profitez des nombreux bienfaits lis la mditation lisolation sensorielle et la flottaison au sel de magnsium pour une relaxation trs profonde OwlCarouselrails Thank you for your interest Initiation la clef de sol jeu de lecture de note OBD connector location Opel Corsa D Interpreting AB Test using Python ChihJen Lins recent papers full list and BibTeX file munkres Adagio In D Minor John Murphy Piano Tutorial Synthesia Epilogue Exercises Google Auth Library for Ruby Idriss Aberkane Map marker CSS only Recurse Center Alla Turca Turkish March Sonata No Wolfgang Amadeus Mozart Piano Tutorial Synthesia How To Track Your AdWords Competitors Over Time Using Auction Insights Using OAuth for Server to Server Applications GitHub public key authentication Optimization bakeoff Game of Thrones episode chapter coverage Categories How to point naked domain and www to the same Heroku app Service Worker API React with Flux by example a simple Todo List dissected Tracking things may require a license What TheFlexBox ECMAScript Tutorial Mark Needham Payer son stationnement Petit tour du propritaire Pubs of the British Isles Recent Posts Mozilla Item to upvote View css code Thank you from Justin Gordon and ShakaCode Comments Be part of the largest API community Coding Education Grammar Chinese Donuts Navbar template When in doubt move around Get Started With EquityOwl React For Beginners Question text There was a problem loading Mapbox Studio Have a look San Franciscos PayByPhone System is One of the Largest NFC Projects in the World Comments Transcription by Ray Pansoy for impekable on Jan Le parlement europen parle dconomie du partage la commission parle dconomie collaborative si lEurope nest mme pas daccord sur le nom donner ce qui pousse les chauffeurs de taxi dans la rue il y aura faire Le Parlement europen a en tout cas publi il y a quelques jours sa vision de ce phnomne Welcome to Poppys World Liens secondaires Les objectifs Next Steps Equipe Inscrivezvous la Newsletter Elle est sympa vous verrez et ne vous spammera jamais ou avec votre compte MindMeister Offline Plugin for webpack More information Rfrences Final Steps Speech to text conversion powered by machine learning Subscribe to our newsletter Pourquoi apprendre Ruby on Rails hours of Sublime Tutor will get you saved hours of your actual development time Share with the world Takeaways Devise License Transcription by Fontfabric on Jan subscribe and never miss a post Software License End The Billing Bottleneck API Reference Subscribe to Chainline Action Cable Overview Additional Resources Pricing most viewed Not the answer youre looking for Browse other questions tagged nodejs unix npm or ask your own question Informations pratiques The Solution Transcription Conclusion Examples Completed while attending Hacker School Data model Next Steps The awards for design creativity and innovation on the Internet Discovery Thursday Domain vs Domain in SEMrush All Our Apps Post navigation Mozilla Alternatives Not the answer youre looking for Browse other questions tagged networking wireless networkmanager asus or ask your own question Get help Promise API reference Adding JavaScript packages Conclusion Le professeur Experience the magic of social dining Usage Navigation Systems rflexions sur Dix pistes pour dresser sa crativit la me ne va pas du tout vous tonner prouver du dsir Solutions la une sur start The Power of well Power FAQ Retrieving an Address for a Place ID Transcription License Conclusion contact Going further Know Your VC Subscribe Customers Also Bought How To Use Device and Cloud Databases with User Defined Targets WhatRuns Related Tutorials Global Google developer blogs Editors Choice Transcription Apps multiplateformes Posts navigation Typely Expression Evaluation via eval The device andor browser you are using does not have the capabilities to support viewing or creating content on awe at this time We recommend using the latest versions of Chrome Firefox or Safari Contributing The Site Articles en relation Devise Where to Share Frequently Asked Questions Comments License Moona Sample issue Whats next License Science latest Final Thoughts Share Sign in to continue to Docs Configure Cloudflare and Heroku over HTTPS Not the answer youre looking for Browse other questions tagged rubyonrails facebook authentication callback omniauth or ask your own question Stats by Country Stats by Country References Improving our app A guided tour through D version force simulations with dynamic data and user interaction Conclusion Text Fields Search Options Sign up for our mailing list En relation Search Options Conclusion Recent posts on the Threadwatchorg Mise en oeuvre What happened Copyright DVELOPPEUR PYTHON STARTUP HF The new features of the ECMAScript specification th edition Contributing Growbot Standuply FaceMatch Niles Revise Bot Quizdom Hyphen ReviewQ Output Examples The Best Parking Apps Youve Never Heard Of and Why You Havent From jQuery to DOM and ES Sketch together with your teammates in realtime Not the answer youre looking for Browse other questions tagged rubyonrails devise rubyonrails pundit or ask your own question Sign up for our Updates Users who have contributed to this file PAR COURRIER FAQ Christine Boutin met fin sa carrire politique Requests Simple plainEnglish explanations accompanied by math code and realworld examples Whos who Notre Blog Programme de la formation e anne Programme de la formation thoughts on Five Tribes of Machine Learning Crer un nouveau compte rflexions au sujet de faons daugmenter la dopamine dans votre cerveau Guide de prparation Tajine au poulet pruneaux et amandes Smartphones are changing how we thinkbecause theyre a part of how we think Get a new marketoon each week Huile de vitamine D Pour aller plus loin Sign up for the Thrive Global newsletter Accessibilit pour tous About Me Commentaires accentus When your enthusiasm dwindles sell your app to someone who has more motivation time energy Borderline is a marketplace for side projects Sell your application give them away or barter them for someone elses project that excites you It beats letting your work starve for attention and go waste What other items do customers buy after viewing this item la une sur start Posts navigation Pourquoi le Taux de LDH Estil Important Using a mobile device Go to httpmhuffingtonpostfr for HuffPost Mobile Get in touch Ces annonces peuvent aussi vous intresser Ces annonces peuvent aussi vous intresser Ces annonces peuvent aussi vous intresser Ces annonces peuvent aussi vous intresser Le chargement semble prendre du temps Partager lusage dune voiture ou dune station de charge En continu Afficher masquer les analyses Fonctionnalit lie au compte utilisateur Pour personnaliser laffichage du flux continu vous devez tre connect Connectezvous Afficher masquer les contenus En bref Fonctionnalit lie au compte utilisateur Pour personnaliser laffichage du flux continu vous devez tre connect Connectezvous Afficher masquer les contenus en accs libre Fonctionnalit lie au compte utilisateur Pour personnaliser laffichage du flux continu vous devez tre connect Connectezvous Afficher masquer les bons plans Fonctionnalit lie au compte utilisateur Pour personnaliser laffichage du flux continu vous devez tre connect Connectezvous Afficher masquer mes flux RSS personnels Fonctionnalit Premium Pour afficher vos flux RSS dans le flux continu vous devez disposer dun abonnement Premium partir de par mois Abonnezvous Sign in to continue to Google Cloud Platform With Safari you learn the way you learn best Get unlimited access to videos live online training learning paths books interactive tutorials and more Courbevoie LevalloisPerret Eureka Youve found our little secret Publications iHeartTypeScript Examples Exercises Exercises Leave a comment More information RSpec Documentation Documentation and resources Need a developer Derniers billets Not the answer youre looking for Browse other questions tagged python nlp nltk or ask your own question Interstellar travel and posthumans LICENSE Not the answer youre looking for Browse other questions tagged python userinterface or ask your own question Ideas Are Nice But EvidenceBased Conversion Patterns Are Better Browser and node versions a Ruby regular expression editor Download Legend Conclusion Updates Desktop Liberation Comparing the Results Desktop Liberation My book Software Engineer at Ad Hoc LLC Living the remotelife If your code is killing you and the joy is gone POODR has the cure The exceptionally handsome dashboard framework Quotes from The Circle Reference Navigation menu jobs sur AZERTY Jobs Sign up for our mailing list Redis News Mapping it out APIs for locationbased apps Pen Actions Latest Best Picks Store Mozilla Next Error Messageback to top Mozilla Learning Machine Learning Weekend Deals For Techies and Outdoor Lighting Enthusiasts Mozilla Running Neoj spatial code from the commandline Responses to this article Sign up Conclusion Customizing Maps lessons SimpleForm and custom inputs Not the answer youre looking for Browse other questions tagged javascript html googlemaps gps tracking or ask your own question Accomplissements Integrated intelligence for every stage of your sales marketing workflow Just Married Join Coolors View All On One Page Welcome to the Product Hunt API Dcouvrez aussi ce cours en Contributing Final Thoughts A Guide to Testing Rails Applications About The Collection La flottaison en isolation sensorielle est la spcialit de meiso License Request your personal demo Review Get mappin With Safari you learn the way you learn best Get unlimited access to videos live online training learning paths books interactive tutorials and more Support Menu de navigation Upcoming batches How To Use The Script Calling Google APIs What you need to know Open Beta Download Recommendations for optimizing Python code Settings thoughts on Mining Twitter Data with Python and JS Part Geolocation and Interactive Maps Not the answer youre looking for Browse other questions tagged domains dns subdomain cname heroku or ask your own question Mozilla The sensor Parameter Related Tutorials Neoj Loading JSON documents with Cypher Restez connect La compilation Dask Arrays Related How the web works Kudoz serverrenderjs Ajouter Similar Articles If You Found this Helpful Share Bonus digression What the heck is the keys method and why doesnt it sort the results Schedule a Demo READMEmd All Posts Sign Contract Package FAQ Common questions Mic Product Blog Other Directories Ajouter Jobs for Designers The Physics of Nearly Killing Yourself on a Motorcycle Livre Blanc RGPD quels impacts pour vos actions marketing Pioneer the Development of Augmented Reality Security Considerations Le Magazine Change de job monte une startup Adrian Li Exclusive tips howtos news and comment Contribute Analyseur lexical Engage Learn More Ajouter About RStudio Suiveznous Ajouter Sublime Text Tips Parameters ABOUT THE AUTHOR READMEmd Detailed instructions Ajouter Publishers Search Instagram or Twitter for photos videos and easily embed on your blog or website Ajouter Jobs for Designers Ajouter Implementing JSON API in a Rails API Wrapup Forces Feedback change edition more stack exchange communities Ajouter Looks pretty good Books As a JavaScript Library Send feedback about Hire us Dev Channel Free ebook Mobile Design Trends Related posts Upload and share Search Converting to a Custom Setup more stack exchange communities Ajouter Contribute Contribute Mdias et guerre de linfo Ajouter Baqend Blog Bikerr rstacruz Get your own Tau Tee Suiveznous Et recevez les jobs confidentiels jusqu K Trackbacks Private Party Modifying the sentiment training data CodePen Radio Laisser un commentaire Annuler la rponse Suiveznous sur Google D controls Appendix Other Options Vendredi et laventure du stage partag et engag It can be stressful to find the right tool to start your project You could choose something simple but five years from now youll have to switch to something more capable Or you could start off with a big complex tool But this is way too complicated at the beginning and slows you down You say JavaScript funny Send feedback about Ajouter Watched Ajouter A proxy handler on function LES PETITS PLUS Ready to try JavaScript Rails Discussion Editors Recommendations san diego california About Apple Rendering Ajouter Social Introduction Calling all aliens Whats the best way to contact our galactic neighbors Ajouter Travaille avec nous Social Navigation READMEmd HTML is awesome Laisser un commentaire Cancel Reply READMEmd Livre Blanc RGPD quels impacts pour vos actions marketing Course Month Payment Plan Coupon Discount READMEmd Discussion Ajouter How to run tests Weve noticed youre adblocking Experimental Results Related articles Post as a guest Requirements Taggings NinjaConcept An Android Wear app Companies Ajouter Liens externesModifier Connect Grand Cru Scopitone Maurice Benayoun Le Pixel Blanc Connect with the author Password recovery Interaction avec la carte cre freeCodeCamp freeCodeCamp HTTPClient Towards Data Science Ajouter Les dernires offres demploi Hacker Noon Components Hippo Pages Slashdot Follow us Post as a guest Cancel reply alpha Udacity A Udacity tem uma pgina em portugus para voc Theres a local version of Udacity for you Sprechen Sie Deutsch Article prcdent Ajouter By Language freeCodeCamp freeCodeCamp Machine Learning for Humans DEVELOPPEMENT WEB MOBILE Leave a Reply Cancel reply SNCF Schneider Electric Unibail Rodamco Connexient Speaking on Indoor Location Whats in your bag Dieter Bohn Esprit Science Mtaphysiquescom est un site de nouvelles et de conscience qui cherche briser les chanes de la pense conventionnelle Si vous tes en rsonance avec ce que vous voyez ici vous pouvez nous suivre en cliquant sur lune des icnes de rseaux sociaux cidessous Crdit de limage principale du site et de la page Google Android Jones androidjonescom Avis sur la recette Tajine au poulet pruneaux et amandes How We Get To Next Ajouter Leave a Reply Cancel reply Ce produit est en cours de rapprovisionnement a fait le buzz codeburst Anna Lundberg Coach Speaker Writer helping people reimagine success in their personal and professional lives onestepoutsidecom Heures limites de dpt READMEmd Ajouter Objets internes Engineering Housing Mme pas mal le jour J Most recent customer reviews Vendredi et laventure du stage partag et engag Nouveau programme de mentorat priv maintenant disponible Register for FREE Get your Pluralsight IQ Vidos ne pas rater BI vous recommande false READMEmd READMEmd READMEmd Smartphone Meizu MS de Go euros READMEmd READMEmd READMEmd READMEmd READMEmd READMEmd READMEmd Hello And More Books Text Wrapping Other Python Libraries Build comparison tables or lists about everything Very Kind Open Source Replacing keys with other keys Policy Specs READMEmd Web Inspector Welcome to the Pure Data site Ajouter Vuforia In the News En conclusion Post as a guest The stupendous timespans of the evolutionary past are now part of common culture Post as a guest Using browser version in electron Regex quick reference Check out Font AwesomeFA Pro FAQ Overtweaking Get the Moz Top For more stuff see my book Going Gas All formats are available now from OReillyAmazon and all good bookshops You can also read a preview on OReilly For more stuff see my book Going Gas All formats are available now from OReillyAmazon and all good bookshops You can also read a preview on OReilly Comments License This organization has no public repositories Popular Answered Questions Other Events Languages Direct Code Links Product Designer STAGE Connect Conclusion Editor Layout Set your site filter C Using a forof loop Sample Response Live Result Leave a Reply Cancel reply Other SVG interfaces Run using mvn execjava Popular articles Markdown Preview Goodbye Ajouter Post as a guest Historic Index Signing up is fast free and easy Greatest Hits current lifecycle event But Suiveznous Leon Le travail sur lego Known Issues Increment Decrement Values With Keyboard Feedback Stuff Things Ajouter Drop in Teen Birthrate Helps Drive Decline in Fertility Temporary Ajouter Rsolvez vos problmes et trouvez de nouvelles ides dans un environnement propice la reflexion For more details visit OwlCarousel landing page Social Meta Ajouter ratchart Storage Dans dautres langues Direct Code Links Ajouter Follow Us StackOverflow Finally we come to the anticlimax a oneliner function Leave a Reply Cancel reply Post as a guest Download install and activate Send feedback about Some nice things people have said Categories Restez connect Ionic est un framework qui va vous permettre de crer des applications mobiles en utilisant des technologies Web Ionic se base pour cela sur dautres frameworks technologies qui ont fait leurs preuves Avant de pouvoir commencer il nous faut videmment commencer par installer loutil Home Create Likes About Add To Chrome Facebook Thanks Your color scheme will be reviewed by our hunters In recent months a host of new tools and packages have been announced for working with data at scale in Python For an excellent and entertaining summary of these Id suggest watching Rob Storys Python Data Bikeshed talk from the PyData Seattle conference In this post I discuss a method for AB testing using BetaBinomial Hierarchical models to correct for a common pitfall when testing multiple hypotheses Getting started with the Web is a concise series introducing you to the practicalities of web development Youll set up the tools you need to construct a simple webpage and publish your own simple code Very cool stuff useful and smart GET IT If this projects helps you please give us a star Thank you for considering using React on Rails ADD A NEW RESOURCE For a junior ReactJs posted by hugohow Boot any rails app in under a second Beginner Try this free iTunes App httpmonelinkmeacc Learn piano songs quick and easy httptinyurlcomflowkeymariovereh Support me on Patreon httpwwwpatreoncomMarioverehrer Facebook httpwwwfacebookcomMarioverehrer Twitter httpstwittercomMariov Like I did in previous articles on the series I would love to point out that you should probably set up Babel and follow along the examples with either a REPL or the babelnode CLI and a file Thatll make it so much easier for you to internalize the concepts discussed in the series Delivered by Fastly Rendered by Rackspace nbviewer GitHub repository nltk est une librairie python trs utile pour manipuler du texte Mashape allows you to consume and monitor APIs in your Application giving you a one stop shop for monitoring payments and management In this first article were going to set up some basic tools for doing fundamental data science exercises Our goal is to run machinelearning classification algorithms against large data sets using Apache Spark and Elasticsearch clusters in the cloud Access to whats happening across the globe in real time Speed of discovery and speed to broadcast are essential in todays everevolving world of media If youre reading this post youre probably a corpus linguistics fan who is learning to code with Python using an excellent online tutorial called Natural Language Processing with Python which is also a book you can buy in case you feel like a bit of a freeloader Weve updated this tutorial with uptodate SDKs Check it out here Articles about ridesharing services have blotted every tech blog on the internet but try doing a quick search on the technology behind these mobile apps A computer would deserve to be called intelligent if it could deceive a human into believing that it was human Alan Turing When I was a child I read the book The analytical Engine Computers Past Present and Future by Jeremy Bernstein In your terminal generate SimpleForm Bootstrap config Look at your main applicationscss file to see how SCSS files are imported Ive met a fair amount of ADHD computer programmers over the years A lot of them were fairly successful in their chosen career but they all had some combination of the same issues all people with attention deficitsface distractibility trouble focusing disorganization and so on Who do you need to take your idea or startup to the next level Easily find a perfect fit on EquityOwl No Salaries No Cash Just Equity Getting started is easy Simply create an account to post your ideas or offer your expertise to countless entrepreneurs Totally updated with the latest best practices in React ES React Router and more Free update to all of you who have already purchased the course Enjoy eBook and Screencast Videos Fully updated Were really proud of what weve built here and we hope youll love it too Please try out the new WordPresscom and let us know what you think For OSX Windows and Linux A quick search on Font Reach reveals that Proxima Nova is used by over websites Its the main typeface of some of the most popular companies in digital media including BuzzFeed Mashable NBC News Wired andyou guessed itMic SAN FRANCISCO Calif Dec PayByPhone a leading international provider of systems for parking and urban mobility payments today announced one of the largest deployments of near field communications NFC payment solutions in the world Were working to make every smartphone a Magic Window into the world See how a sofa looks in your living room Know which exit to take when you get off the subway Play with a virtual cat that jumps on your lap With a few extra sensors and some software magic your device understands the world the by for impekable keyboard shortcuts L or F like Z toggle zoom post comment Le parlement europen parle dconomie du partage la commission parle dconomie collaborative si lEurope nest mme pas daccord sur le nom donner ce qui pousse les chauffeurs de taxi dans la rue il y aura faire Epic CountryLevel AB Test Proves Open Is Better Than Closed The Soviet Unions demise set Estonia and Belarus on opposite paths at the same moment in history years on the results are clear La startup OnePark spcialise dans la rservation de parking vient de lever millions deuros auprs de plusieurs investisseurs dont le transporteur public Keolis filiale de la SNCF The most common use case for serverside rendering is to handle the initial render when a user or search engine crawler first requests our app When the server receives the request it renders the required components into an HTML string and then sends it as a response to the client La sortie en grande pompe du rapport Terrasse signe dune certaine faon lentre de lconomie collaborative sur la scne politique la vraie Pourtant javoue avoir de plus en plus de mal rprimer un sentiment de malaise Beaucoup ont envie dentreprendre mais manquent dides viables ou ont du mal trouver de bons associs On runit pour vous des dizaines de personnes complmentaires et qualifies I recently upgraded to Sublime Text and rather than copy over my old packages I decided to start fresh Im assuming that you already have the Package Control Package Manager installed and you know how to use it If not go here httpspackagecontrolio LA PETITE HISTOIRE A quelques mtres de la place de la Rpublique exactement minute de la sortie du mtro n cet Anticaf est le me ouvrir en rgion parisienne Overwhelmed by service workers Heres a collection of tools and libraries that will help tame this powerful beast Offlinefirst fast with the swprecache module is the tagline of the Googlebuilt swprecache library The web app manifest is a simple JSON file that gives you the developer the ability to control how your app appears to the user in areas where they would expect to see apps for example a mobile devices home screen direct what the user can launch and define its appearance at launch Les CSS Cascading Style Sheets sont un langage permettant de dcrire la restitution de documents HTML et XML lcran sur papier vocalement etc This will take about minutes We will be setting up a Ruby on Rails development environment on Ubuntu Xenial Xerus Google Cloud Speech API enables developers to convert audio to text by applying powerful neural network models in an easy to use API The API recognizes over languages and variants to support your global user base In this codelab you learn how to integrate a service worker into an existing application to make the application work offline The application is called Air Horner Click the horn and it makes a sound First lets see what the finished sample app looks like hint its amazing Beginner Try this free iTunes App httpmonelinkmeacc Learn piano songs quick and easy httpbitdoflowkeymarioverehrer Sheet music httpgooglwawS Beginner piano httpgooglCjVDpO My piano httpgoogllIA Website httpwwwmariovereh This past January we Hadley and Wes met and discussed some of the systems challenges facing the Python and R open source communities We facilitate parents life Sign up now lments indispensables pour obtenir un aperu qualitatif de vos contenus sur les rseaux sociaux nous vous proposons ce tutoriel pour suivre pas pas le setup des Meta Tags dans une application Rails Beginner Try this free iTunes App httpmonelinkmeacc Learn piano songs quick and easy httpbitdoflowkeymarioverehrer Sheet music httpgooglvohRz Beginner piano httpgooglCjVDpO My piano httpgoogllIA Website httpwwwmariovereh We believe in the concept of learning by doing Sublime Tutor takes you methodically from the most basic commands to very advanced ones All of this happens inside the editor itself Number of interesting exercises keep you entertained throughout the course This repository is a tutorial for a first contact with the Sinatra gem a DSL for quickly creating web applications in Ruby with minimal effort Do you use tags to organize content on your site This plugin will turn your boring tag list into a magical input that turns each tag into a styleable object with its own delete link Tags Input handles all the data your form just sees a commadelimited list of tags There is a lot of information on the web about how to use serverside rendering or SSR with React But the question youll want to answer first is should I use it Serverside rendering is very cool and a musthave in certain situations but it comes with drawbacks Quickly generate a rails app with the default Wagon configuration using Rails Templates Get a minimal rails app ready to be deployed on Heroku with Bootstrap Simple form and debugging gems The LiveCode Community open source platform provides a way to build applications for mobile desktop and server platforms The visual workflow allows the user to develop apps live using a powerful and uniquelyaccessible language syntax Turbolinks I Cant Believe Its Not Native by Sam StephensonLearn how Turbolinks enables small teams to deliver lightningfast Rails applications in the browser plus highfidelity hybrid apps for iOS and Android all using a shared set of web viewsSAM STEPHENSONHelp us caption translat Beginner Try this free iTunes App httpmonelinkmeacc Learn piano songs quick and easy httptinyurlcomflowkeymariovereh Website httpwwwmarioverehrercom Support me on Patreon httpwwwpatreoncomMarioverehrer Facebook httpwwwfacebookcomMarioverehr Let me start off with comparing Elixir to Ruby and Phoenix to Rails basing on experience with these languagesframeworks Ever since I first tried building projects with Elixir I have come to appreciate how functional languages lead to a much more maintainable codebase Beginner Try this free iTunes App httpmonelinkmeacc Learn piano songs quick and easy httptinyurlcomflowkeymariovereh Support me on Patreon httpwwwpatreoncomMarioverehrer Facebook httpwwwfacebookcomMarioverehrer Twitter httpstwittercomMariov In an earlier post we built a super quick and super simple Rails API using the Active Model Serializer gem and the Active Model Adapter Theres been a lot of growth lately however around JSON API How long is a startup a startup We found ourselves asking this question in a marketing meeting not too long ago It came up because people regularly refer to Chargify as a startup but our company has been around for years Are we still a startup Nope This module implements a velocity Verlet numerical integrator for simulating physical forces on particles The simulation is simplified it assumes a constant unit time step t for each step and a constant unit mass m for all particles Im a programmer and the author of Practical ObjectOriented Design in Ruby POODR and Bottles of OOP Action Cable seamlessly integrates WebSockets with the rest of your Rails application It allows for realtime features to be written in Ruby in the same style and form as the rest of your Rails application while still being performant and scalable Current browsers dont support all the new ECMAScript aka ECMAScript features yet see comptability table You need to use a compiler transpiler to transform your ECMAScript code to ECMAScript compatible code Vibe helps teams improve relationships and facilitate conflict resolution by analyzing team morale We use Natural Language Processing NLP and other aspects of Machine Learning to analyze conversations through Slack Richard Fords Canada his best novel I think is about how the vast and empty space to the north of the United States acts upon that countrys collective imagination Im trying to upgrade to latest version of node Im falling the instructions at httpdavidwalshnameupgradenodejs But im still getting the same error I also looked at the etcsudoers file and the relevant line is The situation You need to add an iOS app to your Rails application Users can login to both locations and youre using Devise for authentication What is Kundalini How does one awaken it What can it do for you What are Chakras Is Kundalini the same as Tantra What is Tantra Where did this knowledge come from What is the science behind it How does one use and practice it in everyday life Is there a dark side to Tantra Will I go insane In our database deduplication work we write software that looks at tens of millions of pairs of records The model assigns each pair a probability that that pair of records refers to the same person This is called pairwise classification Enhances standard checkbox and radio input element to themeable buttons with appropriate hover and active styles Want to learn more about the checkboxradio widget Check out the API documentation Sur dossier et entretien personnel approfondi Recours la Validation des Acquis Professionnels lentre en formation Nos formations trs oprationnelles proposent une pdagogie active anime par des professionnels et une immersion en entreprise pour consolider les acquis Ouicards allows you to easily build flashcards to study for everything Ouicards uses a bucket Leitner System and relies on jQuery and localStorage Google Cloud PubSub brings the scalability flexibility and reliability of enterprise messageoriented middleware to the cloud Lately here at Tryolabs we started gaining interest in big data and search related platforms which are giving us excellent resources to create our complex web applicationsOne of them is Elasticsearch Even though PWAs have been around for more than two years now there are still a bunch of misconceptions about them strikethey only work in Chrome they cant be as smooth as native apps theres no fullscreen mode they have to be SPAs building offlinefirst isnt worth it etcstrike Though the stereotipical developer might be a socially awkward geek developers are among the most active users of social networks They usually prefer sites that are communitydriven and focus on quality content Sometimes you can doeverything right in your AdWords campaign using all the right keywords and making all the right adjustments based on current trends and still experiencemysterious shifts in performance If its on your screen you can turn it into a GIF with just a couple clicks One click to start one click to stop Add captions adjust export size and more With new neural networkarchitectures popping up every now and then its hard to keep track of them all Knowing all the abbreviations being thrown around DCIGN BiLSTM DCGAN anyone can be a bit overwhelming at first In our first selectors article well learn about simple selectors socalled because they directly match one or more elements of a document based on the type of element or its class or id Create React apps with no build configuration Create React App works on macOS Windows and Linux If something doesnt work please file an issue Ive performed a fresh install of Ubuntu on my Asus NVZ Sadly i cannot connect to wireless networks using the NetworkManager I am able to see wireless networks though I tried to connect to my network using the GUI and entered my password But after that nothing happens Sheet Music httpgooglyRnHHans Zimmer Interstellar Main ThemePiano Version by Patrik PietschmannHi my name is Patrik Pietschmann Im a keyboard player arranger and hobby programmer from Germany Since I am a huge fan of Hans Zimmer I did an arrangement of his Main Theme from the Inte Rich offline experiences periodic background syncs push notificationsfunctionality that would normally require a native applicationare coming to the web Service workers provide the technical foundation that all these features rely on Developers prepare yourself for a pivotal moment in the history of web development Promises have arrived natively in JavaScript Cet article fait rfrence aux thories observations et expriences relatives la corruption de notre matrice dexistence Je vous renvoie aux diffrentes tudes menes sur le sujet et pour ma part aux crits de Cameron Day qui savrent plutt complets et pertinents Sheet Music httpsgooglhJdRRamin Djawadi Game of Thrones Main ThemePiano Version by Patrik PietschmannHi my name is Patrik Pietschmann Im a keyboard player arranger and hobby programmer from Germany Since I am a huge fan of Ramin Djawadi I did an arrangement of his Main Theme from t TVShows like Shark Tank US Dragons Den UK or Die Hhle der Lwen DHDL GER offer young startups a onetime opportunity to pitch their products to business magnates in front of a huge audience We load our gems from Rubygems but a lot of you may still be placing your JavaScripts into vendorassetsjavascripts Why not use npm Its actually pretty easy to set up Rails to use npm The best way to load npm packages in Rails is to use npm as your pipeline itself Surface area and volume of a hypersphere We start our investigations with the generalization of a circle to arbitrary dimensions This object called a hypersphere or an n sphere can be defined as follows For convenience we assume that these spheres are centered on the origin Le JavaScript est un langage merveilleux Tout ce que vousavez toujours voulu faire est possible Jobsetio utilise des cookies pour amliorer lexprience de navigation Ces donnes ne seront ni communiques ni utilises pour vous identifier ou vous contacter En cliquant sur le bouton ok vous consentez ce que jobsetio sauvegarde quelques blocs de donnes sur votre ordinateur In this article Ill be giving you a bit of context on why ES ES and TypeScript exist and will provide some concrete examples of key language features to help you make your mind up on what the right solution is for you First things first we need to define our terms Surprise your loved ones Where are you going next Open source communities are made of people who contribute in many different ways What makes a person more likely to continue participating in a project and move into roles of greater responsibility Its the best place to build and deploy a website show off your work build test cases and find inspiration This is CodePen Projects Share us Follow us Cher blournal Jai mis du temps tcrire parce que jtais morte de trouille A chaque fois que javais une ide de sujet je me demandais Estce vraiment indispensable au monde Le mystre la peur laventure le dsir le sentiment dexister pleinement cinq critres pour aider mieux cerner ce quest lamour vrai If youd like to share your visualization with the world follow these simple steps See this tutorial for more Host tensors metadata sprite image and bookmarks TSV files publicly on the web Does that mean that we should just switch to C or Fortran for everything Ada Lovelace Grace Hopper Frances Allen Adele Goldberg Ces noms ne vous disent rien Pourtant sans elles vous ne pourriez peuttre pas lire cet article sur votre ordinateur ou votre smartphone aujourdhui Zenkit is a better Trello than Trello Matthew Hughes January wwwthenextwebcom A perfect start Different tasks need different tools And different people have different preferences Zenkit includes your favorite tools to make you feel at home from day one Who is this For Beginner to Intermediate developers and designers who want to become comfortable with both JavaScript fundamentals and working in the DOM without a library You should already know some JavaScript to start This isnt a JavaScript course Geocoding is the process of converting addresses like Amphitheatre Parkway Mountain View CA into geographic coordinates like latitude and longitude which you can use to place markers or position the map Get Started developing Augmented Reality Apps with Vuforia Unity and publishing to an Android Tablet or Phonel missed a small step for adding the AR camera and Image Target right before you add the Cyber Soldier Ive covered this step here httpwwwvergiumcomimageandarcAlso here is the Webpacker makes it easy to use the JavaScript preprocessor and bundler Webpack to manage applicationlike JavaScript in Rails Original Performance httpswwwyoutubecomwatchvKQCa Beginner Try this free iTunes App httpmonelinkmeacc Learn piano songs quick and easy httptinyurlcomflowkeymariovereh Website httpwwwmarioverehrercom Support me on Patreon httpwwwpatreon Over the last three articles youve learned about some of the biggest changes to JavaScript with the ECMAScript specification les vieux les moins vieux les rveurs les bosseurs les fainants les fous de lecture les sans connexion internet fixe le plus rapide de la ville La fibre optique son plus haut niveau et totalement gratuite bien sr Begin learning here by typing in your first name surrounded by quotation marks and ending with a semicolon For example you could type the name Gregg and then hit enter Already know the basics Skip ahead with JavaScript Road Trip Ce site utilise des cookies En poursuivant la navigation vous acceptez lutilisation des cookies sur votre ordinateur afin damliorer les fonctionnalits et les performances du site Pour en savoir plus rendezvous sur cette page usefulstuff Memo for my beloved students Summary Keyboards shortcuts Mac Special characters Navigate Sublime Text Terminal Chrome Keyboards shortcuts LINUX Sublime Text Terminal Frequently misunderstood error messages NoMethodError undefined method somemethod for someobjectSomeType Ty If you live in one of these metropolitan areas Google will show you where parking is available in real time Theres nothing worse than driving to a busy downtown megaplex and coming to the sudden horrifying realization that there arent anyparking spacesin sight View INSAs incredible GIFITI work in real life The hand painted animated murals by British artist INSA and brought to live when viewed through this new Augmented Reality platformThe term GIFITI was coined by artist INSA when he started creating his unique animated paintings street art that paradoxically is only viewable online Playing with the idea of creating art to be viewed in the hyperreal domain GIFITI is made via a laborious physical process involving numerous layers of painting and meticulous planning Starting where most artwork ends GIFITI entails photographing each layer the artist paints by hand These images are then uploaded and overlaid to create the final piece a looping GIF file which comes to life when released to global audiences online Described as slices of infinite unreality cutting edge art for the tumblr generationNow this GIFITI app enables audiences the chance to experience the GIFITI in real lifeThe creatorBritish artist INSA began his career as a graffiti writer Known worldwide for his trademark graffiti fetish pattern painted as largescale murals around the world this signature design now envelopes bespoke furniture the artists own line of high heels as well as custom cars yacht sails and private collectors homes INSAs work is held in the VA collection London He has exhibited at Tate Britain London as well as in galleries of major cities including Tokyo LA New York San Francisco Hong Kong Berlin and MontrealHe lives and works in London UK Userdefined targets are Image Targets that are created at runtime from camera frames selected by the user Theyshare most of the capabilities of a standard Image Targetwith the exceptionthat they do not support Virtual Buttons TouchTag brings a complete graffiti art studio to your Android powered deviceFeatures include Silky smooth drawing action Animated drips that respond to the accelerometer Tools including pens sprays laser pointers more coming soon Complete control over colours stroke size scaling Anaconda is an opensource package manager environment manager and distribution of the Python and R programming languages Today at CES Lenovo announced the development of the first consumerready smartphone with Project Tango By adding a few extra sensors and some computer vision software Project Tango transforms your smartphone into a magic lens that lets you place digital information on your physical world Several years ago every inch of the New York City Subway system along with other public transportation systems around the world was covered in graffiti Now theres fewer tags but more ways to express yourself The virtual world is one new venue for graffiti and the art of tagging In this minute video I go over the highlights of the differences of the three technologies and describe different use cases for each of them Immatriculation API com Chercher des plaques dimmatriculation franaises Obtenez la marque le modle le numro de chssis la taille du moteur et autres champs de donnes partir dune plaque dimmatriculation franaise Calculate the number of products each supplier is responsible for Output should include supplier ID supplier company name and product count Sort by product count descending and company name alphabetic order Find the customer name who has the highest credit limit Hunter H Jonathan Tzou Makers M Mats Herding Solberg For many use cases writing pandas in pure python and numpy is sufficient In some computationally heavy applications however it can be possible to achieve sizeable speedups by offloading work to cython Oops We cant find the page or app youre looking for If you are the owner of the awe app check that your app mode is set to Public or if only you wish to view it then ensure you are signed into your app ScriptCam is a popular JQuery plugin to manipulate webcams Take snapshots detect movement faces colors QR and barcodes record videoclips show Augmented Reality D objects and organize videochats By the way its free for noncommercial use Ive shown how to write hybrid applications with HTML and Dalvik Its relatively easy to set things up so JavaScript can call Dalvik methods and Dalvik can call JavaScript methods Sil y a bien une question qui revient souvent lorsque lon parle de rfrencement naturel SEO cest celle concernant le taux de clic en fonction du positionnement dans les SERP page de rsultat dun moteur de recherche Quickly generate a rails app with the default Wagon configuration using Rails Templates Get a minimal rails app ready to be deployed on Heroku with Bootstrap Simple form and debugging gems En un utilisateur Facebook a rapport en moyenne dollars contre en Quant Snapchat ce chiffre est beaucoup moins impressionnant Javascript everywhere thats the dream right Writing for your backend the browser iOS and Android all in the same language GET people List people POST people Create person PUT people Replace the collection DELETE people Delete the collection GET peopleid List attribute of a person PUT peopleid update the attributes of a person POST peopleid create a new col Bug reports and pull requests are welcome on GitHub at This project is intended to be a safe welcoming space for collaboration and contributors are expected to adhere to the code of conduct Highlighting is available as open source under the terms of the MIT License Hunter H Michael Flarup Makers M Fabian M Rikke Koblauch Set up a personal color scheme and override Bootstrap default colors in your Rails app Set up personal fonts on your Rails project Design your home page with a transparent navbar About Feedback Newsletter Designers Submit Learn the piano here httpgooglUwCEnPATREON httpswwwpatreoncomAtinPianoFACEBOOK httpwwwfacebookcomAtinPianoTWITTER httpstwittercomAtinPianoSHEETS httpgooglXdcUZaMIDI Patreon exclusive until February thMP httpgooglaixilpIts been way too This is the first article in a series where I will be documenting my experience writing web applications in Python using the Flask microframework CSS Grid is a twodimensional layout system created specifically to tackle gridbased user interfaces on the web Grids are fundamental to the design of layouts What is this How to use It might look like a simple chess problem but this puzzle could finally help scientists uncover what makes the human mind so unique and why it may never be matched by a computer Ever wonder whether your boss has a high degree of emotional intelligence EQ To really find out youd need to measure your bosss current emotional competencies against the set standard of those prolific bosses that display offthecharts EQ Indoor positioning technologies have been widely studied with a number of solutions being proposed yet substantial applications and services are still fairly primitive Sign in with a different account Create account One Google Account for everything Google Sign in with a different account Create account One Google Account for everything Google Heroku is a cloud platform as a service whichsupports several programming languages meaningyou do not have to worry about any infrastructure and can instead focus on your application This article describes how to configure Cloudflare and Heroku to serve your traffic over HTTPS I am trying to implement facebook authentication in Rails application using the Omniauth gem The problem is that the controller action that should be used by the callback is not getting fired and the process imidiately skips to failure with invalid credentials message The Data Science Initiative is organizing for the first time a summer school the Data Science Summer School DS which will be held on the campus of the cole Polytechnique in ParisSaclay from August to September Website Domain StatsAnalysisRanking And Seo Report StatsToolcom is a web service for Website Owners Webmasters and General Internet Users to retrieve information related with Domain Name IP Address Web Server and Search Engine Optimization SEO Website Domain StatsAnalysisRanking And Seo Report StatsToolcom is a web service for Website Owners Webmasters and General Internet Users to retrieve information related with Domain Name IP Address Web Server and Search Engine Optimization SEO This specification defines an API that provides scripted access to geographical location information associated with the hosting device This section describes the status of this document at the time of its publication Other documents may supersede this document This is the first post of a series of four where Ill show the main steps I followed to build Flashcards a single page app that will help users study and learn any subject they want through spaced repetition The backend is a Rails app that will store the information provided by the users Over the year I have tried to do little startup weekend hack projects trying to make an MVP over the weekend So I had this idea of seeing if anyone wanted to do something similar but over screen share and do some paired programming Many companies have a tremendous amount of data which is not just hard to maintain and manage but also hard to understand and analyse Here data visualisation should find a remedy The main goal is to communicate information clearly and efficiently which improves the overall experience Android Things supports both Bluetooth and Bluetooth Low Energy APIs In this blog post we will use the Bluetooth LE API to communicate between a server an Android Things board and a client an Android app on a phone watch MENTIONS LGALES CONNEXION Nous sommes comet la nouvelle manire de travailler en techdata comet connecte les meilleurs freelances techdata avec les entreprises les plus innovantes Components For free sheet music and midi files visit httppianofoxnetDesign your own Tshirts hoodies cases httpplutaxspreadshirtcomgoogle httpsplusgooglecomuPeterPlufacebook httpswwwfacebookcompeteraxon add me as friend or follow httpswwwfacebookcompa Les dfinitions de la srendipit sont trs nombreuses Statistical significance indicates how likely it is that a marketing campaign was directly responsible for its recipients behavior This font was found on the internet and did not come with a license While we try to make sure that all the fonts on fontsquirrel On March th congress passed a law that makes it legal for your Internet Service Providers ISP to track and sell your personal activity online This means that things you search for buy read and say can be collected by corporations and used against you Philosophe critique dart crivain et artiste multimdia Philippe Boisnard ne cesse dexplorer notre futur immdiat au travers de performances audiovisuelles dinstallations interactives et de crations mettant en jeu le flux incessant des donnes qui transitent sur Internet React Native is a modern framework that allows JavaScript to run on and interact with IOS and Android phones in the same way as native code does What is the best way to get the most out of your brain originally appeared on Quora the place to gain and share knowledge empowering people to learn from others and better understand the world La proprit geolocate si elle est positione true permet de dclencher sous rserve dacceptation de linternaute une golocalisation du terminal consultant la page et dutiliser les coordonnes obtenues pour centrer la carte Situe deux pas du canal saint martin cette ancienne picerie a t entirement repense par un architecte afin daccueillir Hubsy Rpublique Congratulations America You elected a racist sexist admitted sexual assaulter and a petty vindictive con man and pathological liar to the highest office in the land Reactjs and Vuejs are two of the most popular JavaScript libraries on the planet They are both powerful and are relatively easy to pick up and run with With so many similarities you might assume that theyre both different versions of the same thing Since the dawn of time the conventional method for getting your HTML up onto a screen was by using serverside rendering It was the only way You loaded up yourhtml pages on your server then your server went and turned them into useful documents on your users browsers Faraday is an HTTP client lib that provides a common interface over many adapters such as NetHTTP and embraces the concept of Rack middleware when processing the requestresponse cycle In this post I will do my best to demystify three dimensionality reduction techniques PCA tSNE and Auto Encoders My main motivation for doing so is that mostly these methods are treated as black boxes and therefore sometime are misused Yes we can Go to my next challenge ctrl enter Go back to typeform Another great video made in collaboration with Fabrizio Cireddu Root Cause Analysis in points wwwleanmanufacturingpdfcomHere the transcript of the textTipsRulesRoot Cause Analysis Collect correct data Who when where what why how how many Describe process flow standard and current Vous souhaitez prsenter votre entreprise au travers dun reportage video contactez nous videofrenchwebfr This article was translated to Chinese by Jason Cheng Japanese by Postd and Korean by Han JaeYeab EcmaScript or EcmaScript was officially released at the end of June by TC It seems that we are talking a lot about EcmaScript in the last year Its not for nothing reactnativearkit React Native binding for iOS ARKit Getting started npm install reactnativearkit save Mostly automatic installation reactnative link reactnativearkit Manual installation iOS In XCode in the project navigator right click Libraries Add Files to your projects name In WWDC Apple just released ARKit and officially enters the area of Augmented Reality following Google and Facebook This is a big move in AR since the almosteverywhere iPhone will become the first widespread AR device and developers will have a chance to test their AR products on the public When I was thinking about creating something to showcase using ActionCable websockets in a Rails app with React I first thought of building a chat But everybody builds a chat So next I thought about a realtime dashboard Niles is a wiki bot that organizes your teams knowledge and answers common questions directly in Slack Great for Support and Operations save time answering repeated questionsSales close deals faster by getting instant answers to client questions GeoJSON API to get the geolocation of spots where parking is allowed during a specific period of time Bennett Haselton writes If you read no further use either the BestParking or ParkMe app to search all nearby parking garages for the cheapest spot based on the time youre arriving and leaving If you are currently hosting an application on Heroku using the Heroku PostgreSQL addon you get rows for free with the Hobby Dev plan This limit may fill up quite fast depending on your app If so you will receive an email like this one You are not allowed to access this board Request team admin to add you to the team and share the board for the team or ask to set password to the board Currently we are using two separate table for Users and Roles At many places I am doing currentuserroles to fetch the roles of the user Mostly inside pundit policy files Jbuilder is work of many contributors Youre encouraged to submit pull requests propose features and discuss issues Fork the project on Github and check out your copy Safran recherche un Environnement de simulation biomcanique reprsentatif volutif et prexistant permettant dintgrer des corps externes et de grer les interactions hommemachine Clture dcembre Your new and shiny web app probably runs in the cloud and will scale appropriately to the number of requests hitting it This is a living document it describes what features we should implement in priority This document could be influenced by the community feedback security issues stability future needs etc Une question une suggestion une rclamation Nhsitez pas nous contacter Leverage Reduxs strengths to build a Would you Rather application Youll build this dynamic application from scratch while combining the state management features of Redux with the declarative component model from React On vit une poque bizarre Dun ct les femmes veulent avoir une bague au doigt et porter une belle robe blanche De lautre les hommes veulent juste samuser Ontils peur de sengager Ou craignentils les femmes srieuses Labsence de femmes dans la tech seraitelle due une diffrence biologique Cest ce que semble penser un employ de Google Il a expliqu sa vision dans une note interne dvoile par les mdias amricains Full hour course on sale for httpswwwudemycomunderstandjava normal price This is an advanced Javascript course for everyone giving a deep understanding of the language by understanding how it works under the hoodIn the full course you will enhance your abilities as a Javas The documentation for all string methods contains more information The documetation for the Math library contains information about all methods in this library In this article Ill show you how to create and train a neural network using Synapticjs which allows you to do deep learning in Nodejs and the browser Well be creating the simplest neural network possible one that manages to solve the XOR equation Last year I wrote a short book on learning Reactjs which turned out to be about pages This year I am going to challenge myself to summarize it as an article on Medium This article is not going to cover what React is or why you should learn it Part Why Machine Learning Matters The big picture of artificial intelligence and machine learningpast present and future Part Supervised Learning Learning with an answer key Introducing linear regression loss functions overfitting and gradient descent Chez Teemo exDataberries lorsquon reoit un futur client comme McDonalds Systme U ou Carrefour on nhsite pas mettre les petits plats dans les grands pour convaincre de la supriorit technologique de cette petite bote franaise qui monte Une application web doit tre la fois agrable avec une belle interface graphique et efficace grce une mise en page intelligente et ergonomique Obtenez un titre professionnel RNCP en mois formation thorique en centre de formation et stage en entreprise Le Dveloppeurse Logiciel propose les solutions techniques envisages aprs avoir analys dans le dtail les besoins des utilisateurs etou du client Tl Research in artificial intelligence AIand machine learning ML has been going on for decades Indeed the textbook Artificial Intelligence A Modern Approach reveals a dizzying variety of learning algorithms and inference schemes Recevoir les offres promotionnelles et exclusives de Smartbox Recevoir les meilleures offres des partenaires slectionns par Smartbox Search Images Maps Play YouTube News Gmail Drive More Web History Settings Sign in AdvertisingProgramsBusiness SolutionsGoogleAbout Google Privacy Terms Thatsnot great For comparison ARKit on iOS is going to support million devices at launch very rough numbers ARKit runs on any new iPhone Apples released over the past two years iPhone SSE and they sell over million a year Hardware fragmentation is a tough problem to solve More articles Last week in San Francisco Google showed me an app called Oz Oz is a kind of augmented reality picture book it places animated characters from The Wizard of Oz into the physical world as viewed through a smartphone camera Les niveaux de dopamine faibles peuvent causer la dpression une perte de satisfaction des envies les compulsions une faible libido et une incapacit se concentrer Prparation TAPE Faites revenir les morceaux de poulet dans une sauteuse ou directement dans le tajine avec lhuile jusqu ce quils soient bien dors TAPE Une fois cuits retirezles et remplacezles par les oignons en baissant le feu sous la cocotte pour ne pas les faire brunir In BC Socrates worried about what new technology was doing to young peoples brains As younger scholars moved from oral arguments to written ones Socrates argued against writing which he felt would create forgetfulness in the learners souls because they will not use their memories Sheet Music httpsgooglqBPuFyThe Dark Knight Main Theme Piano VersionPiano Version by Patrik PietschmannHi my name is Patrik Pietschmann Im a keyboard player arranger and hobby programmer from Germany Since I am a huge fan of Hans Zimmer I did an arrangement of the Main Theme from Th One of the easiest ways to gauge the culture of innovative in an organization is to see how that organization deals with failure If unchecked failure carries a stigma that can paralyze companies from trying new things Le Matak stimule votre systme immunitaire et donne du tonus votre organisme lorsquil en a le plus besoin Le Matak est un champignon brun lamellaire utilis depuis trs longtemps dans la cuisine asiatique comme au Japon et en Chine En tant que financeur de formation Ple emploi doit sassurer que les organismes de formation dispensent des formations de qualit en rpondant aux critres du dcret n du juin En tant que financeur de formation Ple emploi doit sassurer que les organismes de formation dispensent des formations de qualit en rpondant aux critres du dcret n du juin Photo par Grammes There are several reasons why coders should contribute to open source projects These projects give you real world experience using GitHub reading documentation evaluating issues and fixing code In September I walked out of my office and into the unknown I had resigned from my job the first after my studies with no concrete plans as to what I would be doing next It had started with a request to my boss to take a threemonth sabbatical Il est primordial lorsquon est dveloppeur de rester jour de garder un oeil sur ce qui se fait et les volutions de notre mtier aussi bien concernant les produits processus ou technologies que nous sommes amens utiliser au quotidien Pour cela faire de la veille est essentiel Mercredi Septembre Heures douverture Machine Learning is a subfield of computer science that gives computers the ability to learn without being explicitly programmed It explores the study and construction of algorithms that can learn from and make predictions on data Machine Learning is as fascinating as it is broad in scope Every week we feature the type of brainteasing question that might be asked in a fullstack developers job interview at places such as Google and Facebook You have a bag containing tiles with numbers written on them The YogaFactory vous explique comment faire la pose du corbeau Avec nos astuces le yoga na jamais t aussi facile Il est impossible dcrire un programme sans utiliser de variable Ce terme dsigne le fait dattribuer un nom ou identificateur des informations en les nommant on peut manipuler ces informations beaucoup plus facilement Fully functional real time Video and Group Text chat app similar to Viber or WhatsApp It has full multiplatform support for iOS Android macOS Windows and Linux built using Ionic Last year we launched our PWA with an aim to improve the experience of our users on slow and inconsistent network connections It was the first step towards the quality of the products we strive for Cette anne cest promis vous ne vous laisserez pas dborder par la rentre Tour dhorizon des applis made in France qui vous aideront rester zen dans les semaines venir Lorsquon cre une startup on lit beaucoup de bons ou de moins bons conseils Mais deux choses reviennent assez vite regrouper des profils complmentaires et intgrer un profil technique dans lquipe fondatrice pour une startup web Calculate the number of products each supplier is responsible for Output should include supplier ID supplier company name and product count Sort by product count descending and company name alphabetic order Find the customer name who has the highest credit limit Dans le Stade IV le mlanome sest propag audel du ganglion lymphatique rgional des rgions plus loignes du corps Ce questionnaire ne doit tre rempli que lorsque vous aurez lu notre section FAQ que vous aurez trouv des rponses vos questions puis que vous aurez dtermin que vous voulez que vous tes prt et que vous tes en mesure dinvestir un minimum de pour un participer un pro ES is a major update to the JavaScript languageit now looks and feels modern and the updated features fix many problems with the earlier JavaScript versions If you want to keep your JavaScript developing skills up to date this course Rapid ES Training will help you to do that ENVIRONNEMENT LledeFrance a annonc lundi septembre un ensemble de mesures pour encourager le covoiturage au quotidien absolument crucial selon la prsidente de rgion Valrie Pcresse pour lutter contre les embouteillages et la pollution en complment des transports en commun If you can explain properly each function your app why not prototyping it directly by yourself Do not give a functional specification to your developers build a prototype in order to test it with your users This paste expires on View raw Pasted through web Trouvez votre bien tout moment Le Quartier de cet appartement Juste cot Appartement p ch m Courbevoie Appartement p ch m Courbevoie Appartement p ch m Cour Prix au m fourni titre indicatif seul un professionnel de limmobilier peut vous donner une estimation en accord avec le march Prix au m fourni titre indicatif seul un professionnel de limmobilier peut vous donner une estimation en accord avec le march Prix au m fourni titre indicatif seul un professionnel de limmobilier peut vous donner une estimation en accord avec le march Prix au m fourni titre indicatif seul un professionnel de limmobilier peut vous donner une estimation en accord avec le march In the process Letgo has become the startup worlds newest unicorn worth over billion having raised more than million to date Letgo was founded in and is available for iPhone and Android devices With a Codecademy Pro membership youll get access to extra projects and quizzes for every course Plus ondemand support from our advisors Startup funding stages Seed Round Series A IPO SanFranciscoVC reactboilerplate Simple react starter with the following config React ReactDOM Webpack Babel with es and react presets Bootstrap css only loaded from a cdn in indexhtml work with js or jsx files main applicationscss stylesheet is imported in index reactboilerplate Simple react starter with the following config React ReactDOM Webpack Babel with es and react presets Bootstrap css only loaded from a cdn in indexhtml work with js or jsx files main applicationscss stylesheet is imported in index reduxboilerplate Simple React Redux starter with the following config React ReactDOM Redux ReactRedux Webpack Babel with es and react presets Bootstrap css only loaded from a cdn in indexhtml work with js or jsx files main applicationscss stylesheet is imported in index I posted a question on StackOverflow but it hasnt gotten much traction so I thought Id ask here especially since its a better place for such a discussion probably Cest une sorte de petite rpublique verte observe par le monde entier A New York une cinquantaine dhabitants de President Street dans le quartier de Brooklyn ont mis en place un microrseau de production dchange et de revente dnergie photovoltaque entre voisins Avec leConnect Auto Samsung propose un produit intressant Il sagit en effet dun petit dongle qui se connecte sur le port OBD II de votre voiture afin de vous donner en temps rel des informations sur votre conduite et votre voiture tout en faisant office de hot spot GWiFi Rails app generated with lewagonrailstemplates created by the Le Wagon coding bootcamp team reduxrouterboilerplate Simple React Router Redux starter with the following config React ReactDOM Redux ReactRedux ReactRouterDOM Webpack Babel with es and react presets Bootstrap css only loaded from a cdn in indexhtml work with js or jsx files main application reduxrouterboilerplate Simple React Router Redux starter with the following config React ReactDOM Redux ReactRedux ReactRouterDOM Webpack Babel with es and react presets Bootstrap css only loaded from a cdn in indexhtml work with js or jsx files main application reactboilerplate Simple react starter with the following config React ReactDOM Webpack Babel with es and react presets Bootstrap css only loaded from a cdn in indexhtml work with js or jsx files main applicationscss stylesheet is imported in index Dans le champ Mtier comptence mot cl vous pouvez saisir par exemple serveur anglais brasserie en tapant sur la touche entre entre chaque mot Vous recherchez une offre prcise Saisissez directement sa rfrence par exemple RSNK Dans le champ Mtier comptence mot cl vous pouvez saisir par exemple serveur anglais brasserie en tapant sur la touche entre entre chaque mot Vous recherchez une offre prcise Saisissez directement sa rfrence par exemple RSNK Dans le champ Mtier comptence mot cl vous pouvez saisir par exemple serveur anglais brasserie en tapant sur la touche entre entre chaque mot Vous recherchez une offre prcise Saisissez directement sa rfrence par exemple RSNK Dans le champ Mtier comptence mot cl vous pouvez saisir par exemple serveur anglais brasserie en tapant sur la touche entre entre chaque mot Vous recherchez une offre prcise Saisissez directement sa rfrence par exemple RSNK Stay ahead with the worlds most comprehensive technology and business learning platform With Safari you learn the way you learn best Get unlimited access to videos live online training learning paths books tutorials and more Start Free Trial No credit card required Chapter My Nyan Cat My View Lebowski Furniture Granit t Collaboration avecwith La planche roulettes Expos Insta Press Call reactboilerplate Simple react starter with the following config React ReactDOM Webpack Babel with es and react presets Bootstrap css only loaded from a cdn in indexhtml work with js or jsx files main applicationscss stylesheet is imported in index reduxboilerplate Simple React Redux starter with the following config React ReactDOM Redux ReactRedux Webpack Babel with es and react presets Bootstrap css only loaded from a cdn in indexhtml work with js or jsx files main applicationscss stylesheet is imported in index reduxrouterboilerplate Simple React Router Redux starter with the following config React ReactDOM Redux ReactRedux ReactRouterDOM Webpack Babel with es and react presets Bootstrap css only loaded from a cdn in indexhtml work with js or jsx files main application Prix au m fourni titre indicatif seul un professionnel de limmobilier peut vous donner une estimation en accord avec le march Prix au m fourni titre indicatif seul un professionnel de limmobilier peut vous donner une estimation en accord avec le march Trouvez votre bien tout moment Le Quartier de cet appartement Juste cot Appartement p ch m AsnieressurSeine Appartement p ch m AsniressurSeine Appartement p ch m Trouvez votre bien tout moment Le Quartier de cet appartement Juste cot Appartement p ch m AsnieressurSeine Appartement p ch m AsniressurSeine Appartement p ch m Prix au m fourni titre indicatif seul un professionnel de limmobilier peut vous donner une estimation en accord avec le march You Team SkyCube have outdone yourselves Not only did you meet our original K funding goal you surpassed our stretch goal of K Everyone knows Neil Armstrongs most famous quote But heres something else he said Science has not yet mastered prophecy Link Checker Check links and anchors in Web pages or full Web sites TypeScript is now available Download our latest version today JavaScript that scales TypeScript is a typed superset of JavaScript that compiles to plain JavaScript Any browser Any host Any OS Open source Reorder elements in a list or grid using the mouse Enable a group of DOM elements to be sortable Click on and drag an element to a new spot within the list and the other items will adjust to fit By default sortable items share draggable properties The most important source of texts is undoubtedly the Web Its convenient to have existing text collections to explore such as the corpora we saw in the previous chapters However you probably have your own text sources in mind and need to learn how to access them By now you will have a sense of the capabilities of the Python programming language for processing natural language However if youre new to Python or to programming you may still be wrestling with Python and not feel like you are in full control yet Business IT development Frameworks Lastupdate So far almost all space programs were led by goverment or military And very little were initiated by amateur group like AMSAT Individual fantasies were used and fostered by institutions Its time to have a private connection between you and universe As well as using your mouse to operate software you can also use your keyboard to perform specific functions This page provides a list of keyboard shortcuts which you may find useful Traditionally keyboard shortcuts are written like so Alt F The GeoLocation API is one of the most exciting new web technologies to surface in recent years The API allows you to pinpoint a users location by taking advantage of a devices location capabilities such as a GPS receiver You can also use the API with devices that dont have GPS Pundit provides a set of helpers which guide you in leveraging regular Ruby classes and object oriented design patterns to build a simple robust and scaleable authorization system For more examples you should check out the integration tests If youre using Savon and you or your company is making money from it then please consider donating via Gittip so that I can continue to improve it The five modern web browsers are Internet Explorer Firefox Safari Chrome and Opera DashingDjscom will focus on the web browsers that use WebKit WebKit is a layout engine software designed to allow web browsers to render web pages WebKit powers the Apple Safari and Google Chrome browsers Pure Data is the mainvanilla distribution chiefly maintained by Miller Puckette As of Note This article was written in and uses old versions of D and TopoJSON I recommend you read my newer tutorial CommandLine Cartography instead In this tutorial Ill cover how to make a modest map from scratch using D and TopoJSON Skyfall piano sheet music is now available at httpdownloadpianosheetmusicnetskyfallpianosheetmusic In this piano tutorial I will show you how to p Using Vuforia with Unity has never been easier Vuforia Chalk makes troubleshooting easy Available now on iOS App Store US Si les liens entrants sont trs importants dans le rfrencement naturel lorganisation du maillage interne de votre site est le prolongement de vos backlinks Loosely ordered with the commands I use most towards the top Sublime also offer full documentation If I were to do I imagine I would need to create my own tagged corpus Is this correct or would it be possible and premitted to use the French Treebank Stewart Butterfield talks about how machine learning can help your work productivity To study pain andMe is making its first foray into athome research We toughened up and put the companys methods to the test Similar to this question Im looking for a way to create a GUI where users are able to see a graph in the graph theory sense and interact with it Vehicles will move across the graph from none to node over time The GoodUI ideas that we are about to show you are being actively AB tested by us and others Sign up to receive email updates with what we learn as we go along Design Data is king Unsubscribe any time Initially well send you emails with top content SuperAgent is lightweight progressive ajax API crafted for flexibility readability and a low learning curve after being frustrated with many of the existing request APIs It also works with Nodejs For a complete Ruby regex guide see the Pickaxe Made by Michael Lovitt lovitt For questions comments or issues visit the Google Group Follow updates at Twitter rubular Donate via s effects processing system to handle the Page Turn Effect cpushackcom points by sohkamyung hour ago hide discuss Build Go programs that run directly on the Xen hypervisor githubcom How Sitting in Front of Your Computer All Day Is Killing You elthco Thanks to robmadole and supercodepoet for icon design review advice some Jekyll help and being all around badass coders HUGE thanks to gtagliala for doing such a fantastic job managing pull requests and issues on the Font Awesome GitHub project One of the unique features of mobile applications is location awareness Mobile users take their devices with them everywhere and adding location awareness to your app offers users a more contextual experience About Can I use provides uptodate browser support tables for support of frontend web technologies on desktop and mobile web browsers The site was built and is maintained by Alexis Deveria with occasional updates provided by the web development community Your business plan is very often the first impression potential investors get about your venture But even if you have a great product team and customers it could also be the last impression the investor gets if you make any of these avoidable mistakes Google added Knowledge Graph functionality to nonEnglish queries including Spanish French German Portuguese Japanese Russian and Italian This update was more than just translation and added enhanced KG capabilities One the things I wanted to play around with was visualizing this site content with d But first I needed to create something which would generate data from the site any domain site actually Its easy enough to modify for nondomain sites but Im starting with domains since thats what I have JSLint Source WarningsFunction ReportProperty Directive Options Assume in development ES a browser CouchDB Nodejs Fudge First line number is Tolerate bitwise operators eval for statement multiple vars single quote strings this whitespace mess Number Click on the buttons to see the effect Last summer I wrote a post comparing the performance of Numba and Cython for optimizing arraybased computation Since posting the page has received thousands of hits and resulted in a number of interesting discussions Whats needed Some parameters Some data As generated bySite data to sheets The column headings are referenced in the first set of parameters above This data can be any suitably formatted dataset Heres a snap Heres the generated thing to play around with ElasticSearch can be downloaded packaged in various formats such as ZIP and TARGZ from elasticsearchorg After downloading and extracting a package running it couldnt be much easier at least if you already have a Java runtime installed To run ElasticSearch on Windows we run elasticsearch In the old days youd override tojson in your model class to provide a JSON implementation of your model Then in your controller render json model would work perfectly And some folks would even redundantly code render json modeltojson and that would work too Menu Neuralink and the Brains Magical Future I knew the future would be shocking but this is a whole other level Read More Everyone gets minute time blocks to use every day How are you using yours Read More In case you missed it heres what happened Practical ObjectOriented Design in Ruby POODR is a programmers tale about how to write objectoriented code Written by Sandi Metz it explains objectoriented design OOD using realistic understandable examples Heres a sample dashboard with widgets With a name of sampleerb it becomes accessible at sample Each widget is represented by a div element needing dataid and dataview attributes The wrapping litags are used for layout Mashape Mashape San Francisco httpwwwmashapecom Joined on Aug Something went wrong with that request Please try again byDave EggersWhen Mae Holland is hired to work for the Circle the worlds most powerful internet company she feels shes been given the opportunity of a lifetime This reference guide documents the SyntheticEvent wrapper that forms part of Reacts Event System See the Handling Events guide to learn more Your event handlers will be passed instances of SyntheticEvent a crossbrowser wrapper around the browsers native event Featured Style WY by Check it out ADVERTISEMENT Most Popular Ultra Light with Labels by hawasan Subtle Grayscale by Paulo Avila Shades of Grey by Adam Krogh Blue water by Xavier explore more Most Recent Stereotype threat is a situational predicament in which people are or feel themselves to be at risk of conforming to stereotypes about their social group This is a list of projects which have curated tasks specifically for new contributors These are a great way to get started with a project or to help share the load of working on open source projects Catgories Types de contrat Chercher Charger plus doffres demplois Download our free beginners guide to fonts Font Squirrel is your best resource for FREE handpicked highquality commercialuse fonts Even if that means we send you elsewhere to get them more info Ready for a test drive Check this interactive tutorial that will walk you through the most important features of Redis Redis is the latest stable version Interested in release candidates or unstable versions Check the downloads page This has been a big year for keyword not provided It has become more difficult than ever to gauge the success of SEO campaigns That single term is now showing for over of LunaMetricscoms organic search traffic Yikes It wasnt many years ago that finding yourself with a hankering for a curry in an unfamiliar city youd two choices trudging the streets or waylaying a local after before webkitboxsizing borderbox mozboxsizing borderbox boxsizing borderbox padding margin Styles body backgroundcolor ddd fontfamily HelveticaHelvetica NeueArial color fontsize px lineheight clear clear both Get the latest Industry news delivered to your inbox each morning Sign up now JSON Web Tokens are an open industry standard RFC method for representing claims securely between two parties JWTIO allows you to decode verify and generate JWT press any key to get the JavaScript event keycode Made with love by Wes Bos fork or suggest edits on GitHub Follow wesbos Tweet strftimified result Thursday May a The abbreviated weekday name Sun A The full weekday name Sunday b The abbreviated month name Jan B The full month name January d Day of the month e Day of the month H Hour of the day hour clock The entries method returns a new Array Iterator object that contains the keyvalue pairs for each index in the array A collection of things I make on the web like DataMaps often with Javascript sometimes with a D Find me on Twitter or Github This past week I had the privilege to speak at the curated track at JSConf on Amelia Island FL Directives for modifying lists with the HTML drag drop API Supports nested lists for building trees and other fancy structures No boilerplate code no jQuery just a few KB You have only but to be approved for a GPN account to gain access to our most uptodate API and the deluge of k deals from all our channels Local Goods Getaways and Occasions will be right at your fingertips The geolocation API allows the user to provide their location to web applications if they so desire For privacy reasons the user is asked for permission to report location information The geolocation API is published through the navigatorgeolocation object Good clicklog datasets are hard to come by LuckilyCriteoLabs released a weeks worth ofdata a whopping GB for a new Kaggle contest The task is to predict the clickthroughrate for ads Top StoriesCantina TalkCantina Talk You Can Bet Carrie Fisher Would Love Episode IXMost PopularMore StoriesMost RecentRead Moreproduct reviewReview Gigabyte Aero A solid if heavy new gaming laptop from Gigabyte The Document Object Model DOM is a programming interface for HTML XML and SVG documents It provides a structured representation of the document as a treeThe DOMdefines methods that allow access to the tree so that they can change the document structure style and content Neoj Spatial is a library facilitating the import storage and querying of spatial data in the Neoj open source graph database This projects manual is deployed as part of the local build as the Neoj Spatial Manual Learn how to use jQuery and the jQuery UI Draggable and Droppable plugins to create draganddrop interfaces in your web pages Includes a full draganddrop card game example Dragging and dropping can be a very intuitive way for users to interact with your site or web app Learn how to use Python with Pandas Matplotlib and other modules to gather insights from and about your data Control hardware with Python programming and the Raspberry Pi Sublime Text ST is lightweight crossplatform code editor known for its speed ease of use and strong community support Its an incredible editor right out of the box but the real power comes from the ability to enhance its functionality using Package Control and creating custom settings Get started creating interactive maps using the Google Maps API In this course youll learn how to create and configure different types of maps how to attach events to these maps and how to create and customize markers Since Rails supports PostgreSQL array type out of the box it would be great to have an opportunity to use it for getting from a form on client side an array of text fields it may be collection of zips for example and pass it to a model Website httpwwwmarioverehrercom Sheet Music and MIDIDonate httpwwwmarioverehrercomdonateFacebook httpwwwfacebookcomMarioverehrerTwitter httpstwittercomMarioverehrerBuy My Music httpwwwloudrfmartistmarioverehWho has never played TetrisFor more awesome tutoria I have read up on GPS Real time tracking and found out several things about it mostly requiring PHP zope and a database to store the incoming data Some other methods uses ajax with relations to PHP Professionnels du SEO Les conditions requises pour tre un bon professionnel du SEO vous aimez aider les entreprises trouver des clients potentiels rassembler des donnes grer des portefeuilles mener des audits de sites Web et prsenter vos succs Nous pouvons le faire Learn about the latest news feature releases and uses of Clearbit data Shorten research time prospect to your ideal accounts and gain the context you need to close more deals with our complete enrichment and prospecting suite The ContentSecurityPolicy header is a bit frightening will I break my website if I suddenly start blocking requests for external resources In this article we go over a gradual approach to adopting CSP Angular is the rave of the moment Hit the spacebar to generate color schemes Click on a color to lock it and get wonderful color combinations Additionally arbitrary scripts can be executed by running npm runscript pkg stage Pre and post commands with matching names will be run for those as well eg premyscript myscript postmyscript The goal of this API is to be RESTful and as simple as needed If you have any ideas for improvements or just wanna chat about JSON and HTTP verbslet us know on GitHub Vous avez toujours eu envie de crer un jeu vido sans jamais oser vous lancer Ce cours est fait pour vous En position de gamelevel designer vous exploiterez les possibilits dUnity pour concevoir votre premier jeu vido un petit plateformer en vue subjective un peu la Deadcore Il devrait tre possible dcrire une histoire de lego en occident dans lavnement de lautobiographie Nous avons vu que dans Les Confessions Saint Augustin inaugurait un style celui de lexpression de la subjectivit Geocoder is a complete geocoding solution for Ruby With Rails it adds geocoding by street or IP address reverse geocoding finding street address based on given coordinates and distance queries Its as simple as calling geocode on your objects and then using a scope like Venue Certain sites occasionally make the same content available via different URLs by using session IDs or other URL parameters A session ID is a number that is appended to a URL path thereby creating a new page with a custom experience for the person visiting the site who corresponds to that ID Sublime Text has a lot of features and shortcuts for the modern coder to play with Lets take a look at the most important which I think will boost your workflow to a new level Learn how to use basic shortcuts work with projects or handle tabs often without even clicking your mouse Rails makes it super easy to write your tests It starts by producing skeleton test code while you are creating your models and controllers By simply running your Rails tests you can ensure your code adheres to the desired functionality even after some major code refactoring Thousands of beautiful images submitted by participant photographers who document Burning Man and related events throughout the years Beginner Try this free iTunes App httpmonelinkmeacc Learn piano songs quick and easy httpbitdoflowkeymarioverehrer Easy sheet music httpgooglmKle Beginner piano httpgooglCjVDpO My piano httpgoogllIA Website httpwwwmario Dan Neil The MercedesAMG GT R We receive SMS and calls from all over the world to our phone numbers in USA UK and Canada Our virtual phone numbers allow you to verify and register for various websites absolutely free The phone numbers are disposable and all messages are discarded after hours The Hebrew language will be way more fun for you now even if you just watch the first minutes of this video for a great tip in learning how to write print beautiful Hebrew letters But if you are looking for a jumpstart into the Hebrew language Teaching Myself Hebrew is a Touch enabled jQuery plugin that lets you create beautiful responsive carousel slider Visit Owl Carousel landing page Tested on IE IE IE IE Chrome Safari Firefox Opera iPhone iPad Chrom on Google Nexus Excited to be working with the apiaryio team Tool is neat and ellegant OOTB GitHub integration and more API First jakubnesetril Ive spent most of my evening knee deep in API docs Writing them not reading them Thanks apiaryio Where is my OBD port Since the implementation of the OBD standard each vehicle has a standard pin connector as described on our OBD presentation page The norm states that the port must be located inside the vehicle passenger compartment Suppose we ran an AB test with two different versions of a web page and for which we count the number of visitors and whether they convert or not We can summarize this in a contingency table showing the frequency distribution of the events ChihJen Lins recent papers full list and BibTeX file Your comments to our work are very welcome These files may be slightly different from the published form because of formatting issues and errorfixing after the publication HF Yu HY Huang I S Dihillon and CJ Lin The Munkres module provides an implementation of the Munkres algorithm also called the Hungarian algorithm or the KuhnMunkres algorithm useful for solving the Assignment Problem Let C be an nxn matrix representing the costs of each of n workers to perform any of n jobs Website httpwwwmarioverehrercom Sheet Music and MIDISupport me on Patreon httpwwwpatreoncomMarioverehrerFacebook httpwwwfacebookcomMarioverehrerTwitter httpstwittercomMarioverehrerBuy My Music httpwwwloudrfmartistmarioverehDonate httpwwwmarioverehrercom First in SVG Land d is an attribute that defines the coordinates of a path Its a crazy combination of letters and numbers Second this is where it helps to remember that a D path is actually a function The code above is equivalent to a more familiar syntax The pinhole camera model or sometimes projective camera model is a widely used camera model in computer vision It is simple and accurate enough for most applications Google Auth Library for Ruby Homepage httpwwwgithubcomgooglegoogleauthlibraryruby Authors Tim Emiola Copyright Copyright Google Inc License Apache Description This is Googles officially supported ruby client library for using OAuth Idriss Aberkane en confrence au Jardin des plantes de Paris en Idriss Aberkane est un enseignant confrencier et essayiste franais What we do The Recurse Center is a selfdirected communitydriven educational retreat for programmers in New York City Our philosophy We believe people learn best when they take control of their own education and are free to explore what theyre interested in Tweet ES ECMAScript New Features Overview Comparison See how cleaner and more concise your JavaScript code can look and start coding in ES now A good programming language is a conceptual universe for thinking about programming Alan J Beginner Try this free iTunes App httpmonelinkmeacc Learn piano songs quick and easy httptinyurlcomflowkeymariovereh Website httpwwwmarioverehrercom Support me on Patreon httpwwwpatreoncomMarioverehrer Facebook httpwwwfacebookcomMarioverehr Its good to know what the competition is doing While you control your bids its your competitors who determine what you actually need to pay and where your ad will be positioned A JWT is composed of three parts a header a claim set and a signature The header and claim set are JSON objects These JSON objects are serialized to UTF bytes then encoded using the Baseurl encoding Parse the mobile app platform has one particularly interesting product Parse Core One of its features allows app developers to store data in the cloud without worrying about setting up servers and designing a REST API After creating a GitHub account you need to setup your computer so that you can git push When cloning a project you chose SSH or HTTPS I like to clone my projects in SSH as it will use my keys Heres a diagram explaining how those keys are used when you want to git push your code ARToolKit is a fast and modern open source tracking and recognition SDK which enables computers to see and understand more in the environment around them clockmorearrownoyes Copenhagen Wheel review a bike that makes you feel like a su Python is a highlevel interpreted language which greatly reduces the time taken to prototyte and develop useful statistical programs However the tradeoff is that pure Python programs can be orders of magnitude slower than programs in compiled languages such as CC or Forran It happens on the web from time to time that powerful technologies come to exist without the benefit of marketing departments or slick packaging They linger and grow at the peripheries becoming oldhat to a tiny group while remaining nearly invisible to everyone else Until someone names them A filledin box means the the episode draws events directly from the chapter this doesnt necessarily mean it covers the entire chapter A dotted box means the episode draws indirectly from the chapter revealing events that occur offpage introducing characters minor details of an event Geolocation is the process of identifying the geographic location of an object such as a mobile phone or a computer Twitter allows its users to provide their location when they publish a tweet in the form of latitude and longitude coordinates I create a simple Rails app and deployed it to Heroku This is my app I use Cloudflare to manage my DNS records and I try to achieve something like this When I go to ordrmy its works like I wanted to But when I go to wwwordr Service workers essentially act as proxy servers that sit between web applications and the browser and network when available As a Rails developer I learned a lot just from reading Ruby on Rails code Aware of that experience I try to look into the internals of other open source projects as well to see whats going on there What is Geocoding Geocoding is the process of converting addresses like Amphitheatre Parkway Mountain View CA into geographic coordinates like latitude and longitude which you can use to place markers on a map or position the map Get access to all videos and download the exercises Join others in learning with Wes Bos Start Here One of the most commonly asked questions I get asked is how to load JSON documents into Neoj and although Cypher doesnt have a LOAD JSON command we can still get JSON data into the graph PARC RIVES DE SEINE Dcouvrez notre webdoc Comment payer son stationnement Paris Voies mixtes voies rotatives on vous explique tout'
! pip install nltk
Requirement already satisfied: nltk in c:usershoustonanaconda3libsite-packages
Requirement already satisfied: six in c:usershoustonanaconda3libsite-packages (from nltk)

Nltk contient un corpus de stopwords en plusieurs langues. On peut enrichir la liste déjà créée.

from wordcloud import WordCloud, STOPWORDS

stopwords = set(STOPWORDS)
{'be', "i'll", 'about', 'am', 'further', 'not', 'very', 'again', 'having', "they'd", 'been', "weren't", 'before', 'during', 'were', "how's", 'hers', 'from', 'yourselves', 'her', "wouldn't", "won't", 'all', "she'll", "you're", 'above', 'at', 'our', 'where', 'up', 'off', 'too', 'com', 'they', 'while', "can't", 'so', 'have', 'my', 'here', 'down', 'we', "hasn't", 'and', 'in', 'through', "they'll", 'your', 'same', 'r', 'ours', 'a', 'why', "where's", 'shall', 'do', "you've", 'them', 'of', 'who', 'ever', 'each', "let's", 'after', 'for', 'other', 'you', 'themselves', 'itself', 'cannot', 'over', 'could', "you'd", 'but', "isn't", 'should', 'then', 'she', "when's", 'it', 'between', 'me', 'this', 'once', 'like', 'own', 'he', 'until', "they're", 'their', 'some', 'that', 'into', 'under', "i've", 'else', "mustn't", "you'll", "he's", 'if', "don't", "there's", "wasn't", "it's", "they've", 'when', "we'd", 'get', "hadn't", 'can', "who's", "haven't", 'there', 'both', "couldn't", "she'd", 'had', 'what', 'how', 'such', "that's", 'whom', 'www', 'has', 'out', 'myself', 'the', 'theirs', 'any', 'are', 'no', 'than', "we'll", 'these', "i'm", 'ourselves', "why's", 'him', 'those', "i'd", 'his', 'on', 'herself', 'against', 'http', "shouldn't", 'does', "she's", "he'll", "we're", 'an', "doesn't", 'its', 'being', 'by', 'or', 'yours', "shan't", "didn't", "he'd", 'is', 'below', "we've", 'nor', 'himself', 'to', 'few', 'k', 'with', 'i', 'which', "aren't", 'ought', 'was', 'would', 'because', 'did', 'doing', 'as', "what's", "here's", 'only', 'yourself', 'most', 'just', 'more'}
for wds in ['http', 'https', 'www', 'fr', 'com', 'io', 'org', 'co', 'jo', 'edu', 'news', 'html', 'htm',\
            'github', 'youtube', 'google', 'blog', 'watch', 'de', 'le', 'la', 'en', 'sur', 'vous', 'les', \
           'ajouter', 'README', 'md', 'et', 'PROCESS', 'CMYK', 'des', 'chargement', 'playlists', 'endobj', \
           'obj','est', 'use', 'using', 'will', 'web', 'first','pour', 'du', 'une', 'que']:
import nltk

stopwords_fr_ntlk = set(nltk.corpus.stopwords.words('french'))
stopwords_en_ntlk = set(nltk.corpus.stopwords.words('english'))
stopwords_clean = [ l.lower() for l in list(stopwords.union(stopwords_fr_ntlk).union(stopwords_en_ntlk))]
%pylab inline
Populating the interactive namespace from numpy and matplotlib
wordcloud = WordCloud(stopwords=stopwords, background_color="white")



On applique tout ça à df_pocket.

def words_cleaning(url,title,excerpt,html_soup):
    url_clean = url_cleaning(url)
    title_clean = nan_to_string(title)
    excerpt_clean = nan_to_string(excerpt)
    h1_clean = hx_cleaning(html_soup,'h1')
    h2_clean = hx_cleaning(html_soup,'h2')
    h3_clean = hx_cleaning(html_soup,'h3')
    p_clean = p_cleaning(html_soup)
    words = ' '.join([url_clean, title_clean, excerpt_clean, h1_clean, h2_clean, h3_clean, p_clean])
    words_clean = re.sub('[^A-Za-z ]','', words)
    words_clean = re.sub('\s+',' ', words_clean)
    words_list = words_clean.split(' ')
    return ' '.join([w.lower() for w in words_list if w not in stopwords_clean])
df_pocket['words_string'] = np.vectorize(words_cleaning)(df_pocket['url'], \
                                                         df_pocket['title'], \
                                                         df_pocket['excerpt'], \
tags url excerpt title domain html_soup words_string
0 [mobile app] Ionic est un framework qui va vous permettre d... Tutoriel Vidéo Apache CordovaIonic Framework {'h2': ['Petit', 'tour', 'du', 'propriétaire']... grafikart tutoriels cordova ionic framework tu...
1 [lewagon] Home Create Likes () About Add To Chrome Faceb... Color Hunt {} colorhunt color hunt home create likes about a...
2 [data science] In recent months, a host of new tools and pack... Out-of-Core Dataframes in Python: Dask and Ope... {'h2': ['Pubs', 'of', 'the', 'British', 'Isles... jakevdp core dataframes python outofcore dataf...
3 [abtest] In this post, I discuss a method for A/B testi... A/B Testing with Hierarchical Models in Python {'h2': ['Recent', 'Posts'], 'h3': ['Related'],... dominodatalab ab testing hierarchical models p...
4 [mdn, documentation] Getting started with the Web is a concise seri... Getting started with the Web {'h2': ['Mozilla'], 'h3': ['How', 'the', 'web'... developer mozilla us docs learn gettingstarted...

A présent la base df_pocket est nettoyée et prête à être utilisée pour les analyses de textes.

Analyse des données textuelles - TD-IDF, similarité cosine et n-grams

Le calcul tf-idf (term frequency–inverse document frequency) permet de calculer un score de proximité entre un terme de recherche et un document (c’est ce que font les moteurs de recherche).

La partie tf calcule une fonction croissante de la fréquence du terme de recherche dans le document à l’étude, la partie idf calcule une fonction inversement proportionnelle à la fréquence du terme dans l’ensemble des documents (ou corpus).

Le score total, obtenu en multipliant les deux composantes, permet ainsi de donner un score d’autant plus élevé que le terme est surréprésenté dans un document (par rapport à l’ensemble des documents). Il existe plusieurs fonctions, qui pénalisent plus ou moins les documents longs, ou qui sont plus ou moins smooth.

corpus = {
 'a' : "Mr. Green killed Colonel Mustard in the study with the candlestick. \
Mr. Green is not a very nice fellow.",
 'b' : "Professor Plum has a green plant in his study.",
 'c' : "Miss Scarlett watered Professor Plum's green plant while he was away \
from his office last week."
terms = {
 'a' : [ i.lower() for i in corpus['a'].split() ],
 'b' : [ i.lower() for i in corpus['b'].split() ],
 'c' : [ i.lower() for i in corpus['c'].split() ]
from math import log

QUERY_TERMS = ['mr.', 'green']

def tf(term, doc, normalize=True):
    doc = doc.lower().split()
    if normalize:
        return doc.count(term.lower()) / float(len(doc))
        return doc.count(term.lower()) / 1.0

def idf(term, corpus):
    num_texts_with_term = len([True for text in corpus if term.lower() \
                              in text.lower().split()])
        return 1.0 + log(float(len(corpus)) / num_texts_with_term)
    except ZeroDivisionError:
        return 1.0

def tf_idf(term, doc, corpus):
    return tf(term, doc) * idf(term, corpus)
for (k, v) in sorted(corpus.items()):
    print(k, ':', v)

query_scores = {'a': 0, 'b': 0, 'c': 0}
for term in [t.lower() for t in QUERY_TERMS]:
    for doc in sorted(corpus):
        print('TF({}): {}'.format(doc, term), tf(term, corpus[doc]))
    print('IDF: {}'.format(term, ), idf(term, corpus.values()))
    for doc in sorted(corpus):
        score = tf_idf(term, corpus[doc], corpus.values())
        print('TF-IDF({}): {}'.format(doc, term), score)
        query_scores[doc] += score

print("Score TF-IDF total pour le terme '{}'".format(' '.join(QUERY_TERMS), ))
for (doc, score) in sorted(query_scores.items()):
    print(doc, score)
a : Mr. Green killed Colonel Mustard in the study with the candlestick. Mr. Green is not a very nice fellow.
b : Professor Plum has a green plant in his study.
c : Miss Scarlett watered Professor Plum's green plant while he was away from his office last week.

TF(a): mr. 0.10526315789473684
TF(b): mr. 0.0
TF(c): mr. 0.0
IDF: mr. 2.09861228866811

TF-IDF(a): mr. 0.22090655670190631
TF-IDF(b): mr. 0.0
TF-IDF(c): mr. 0.0

TF(a): green 0.10526315789473684
TF(b): green 0.1111111111111111
TF(c): green 0.0625
IDF: green 1.0

TF-IDF(a): green 0.10526315789473684
TF-IDF(b): green 0.1111111111111111
TF-IDF(c): green 0.0625

Score TF-IDF total pour le terme 'mr. green'
a 0.3261697145966431
b 0.1111111111111111
c 0.0625

Exercice guidé - Calcul de TF-IDF

Quel document est le plus proche du terme “green plant” ? Calculer les scores TF-IDF pour le terme “green plant”. Cela correspond-il à vos attentes ? Que se passe-t-il avec “green” seul ?

Green plant

from math import log

def tf(term, doc, normalize=True):
    doc = doc.lower().split()
    if normalize:
        return doc.count(term.lower()) / float(len(doc))
        return doc.count(term.lower()) / 1.0

def idf(term, corpus):
    num_texts_with_term = len([True for text in corpus if term.lower()
                              in text.lower().split()])
        return 1.0 + log(float(len(corpus)) / num_texts_with_term)
    except ZeroDivisionError:
        return 1.0

def tf_idf(term, doc, corpus):
    return tf(term, doc) * idf(term, corpus)
QUERY_TERMS = ['green', 'plant']
query_scores = {'a': 0, 'b': 0, 'c': 0}
for term in [t.lower() for t in QUERY_TERMS]:
    for doc in sorted(corpus):
        score = tf_idf(term, corpus[doc], corpus.values())
        query_scores[doc] += score

print("Score TF-IDF total pour le terme '{}'".format(' '.join(QUERY_TERMS), ))
for (doc, score) in sorted(query_scores.items()):
    print(doc, score)
Score TF-IDF total pour le terme 'green plant'
a 0.10526315789473684
b 0.26727390090090714
c 0.1503415692567603

Deux documents possibles : b ou c (a ne contient pas le mot « plant »). B est plus court : donc green plant « pèse » plus.


QUERY_TERMS = ['green']
term = [t.lower() for t in QUERY_TERMS]
term = 'green'

query_scores = {'a': 0, 'b': 0, 'c': 0}

for doc in sorted(corpus):
    score = tf_idf(term, corpus[doc], corpus.values())
    query_scores[doc] += score

print("Score TF-IDF total pour le terme '{}'".format(term))
for (doc, score) in sorted(query_scores.items()):
    print(doc, score)
Score TF-IDF total pour le terme 'green'
a 0.10526315789473684
b 0.1111111111111111
c 0.0625

Exercice 1 - TF-IDF sur des données pocket

Prenez 5 articles enregistrés dans pocket et déterminer leur score pour les mots python, data et science.

Exercice 2 - Création d’un moteur de recherche pour les données pocket

L’idée de cet exercice est de créer un moteur de recherche pour [‘python’,‘data’,‘science’].

Le but : trouver les 5 articles les plus pertinents pour ces termes.

  1. La première étape sera de calculer pour chaque article de la base le score td-idf.

  2. La seconde étape sera de trier ces scores du plus élevé au moins fort.

Exercice 3 - Catégorisation automatique avec des méthodes non supervisées

Avec ce que vous venez d’apprendre (le tf-idf), il est possible de créer un modèle de catégorisation automatique “non-supervisé”. Ce terme barbare signifie que l’on peut créér des tags à partir des seules variables explicatives, sans utiliser de “label”, c’est-à-dire de données qui valident si la prédiction (ici, présence de tel ou tel mot dans les tags) est correcte. Normalement, on utilise ce genre de méthode quand on a pas de labels et que l’on cherche à faire ressortir des régularités (des patterns) dans les données. D’autres méthodes de machine learning non-supervisées connues sont : le clustering, les ACP.

Pour bien comprendre le tf-idf, on vous l’a fait coder “à la main”. En réalité, c’est tellement classique, qu’il existe des librairies qui l’ont déjà codé. Voir scikitlearn.feature_extraction.text

L’idée est la suivante : on va retenir comme “tags”, les 3 mots les plus “caractéristiques” d’un document. C’est-à-dire, les mots correspondants aux 3 scores tf-idf les plus élevés.

Les étapes à suivre : - transformer les mots en vecteurs. L’idée est de créer une matrice, avec en ligne les documents, en colonne les mots possibles (prendre tous le smots uniques présents dans l’ensemble des documents). Cela se fait en 3 lignes de code, voir la documentation scikitlearn.feature_extraction.text - calculer les tf-idf normalisés - récupérer les indices dont les mots ont le score le plus élevé : voir la méthode argsort - récupérer la correspondance mots et indices - récupérer les 3 mots les plus caractéristiques, et comparer aux tags de la table df_pocket

Approche contextuelle

Links: notebook, html, PDF, python, slides, GitHub

Les approches bag-of-words, bien que simplistes, permettent de créer, d’indexer et de comparer des documents. La prise en compte des suites de 2, 3 ou plus mots serait un moyen d’affiner de tels modèles. Cela permet aussi de mieux comprendre le sens des homonymes, et des phrases (d’une manière générale, la sémantique).

nltk offre des methodes pour tenir compte du contexte : pour ce faire, nous calculons les n-grams, c’est-à-dire l’ensemble des co-occurrences successives de mots deux-à-deux (bigrams), trois-à-trois (tri-grams), etc.

En général, on se contente de bi-grams, au mieux de tri-grams : - les modèles de classification, analyse du sentiment, comparaison de documents, etc. qui comparent des n-grams avec n trop grands sont rapidement confrontés au problème de données sparse, cela réduit la capacité prédictive des modèles ; - les performances décroissent très rapidement en fonction de n, et les coûts de stockage des données augmentent rapidement (environ n fois plus élevé que la base de donnée initiale).

référence : introduction à nltk

Dans cette partie, nous allons nous intéresser au nombre d’occurences et de co-occurences des termes dans les articles de la base pocket. Pour cela, nous utilisons les méthodes disponibles dans le package nltk

import re, nltk
#Tokenisation naïve sur les espaces entre les mots => on obtient une liste de mots
tokens = re.split('\s+', ' '.join(df_pocket['words_string']))
#On transforme cette liste en objet nltk "Text" (objet chaine de caractère qui conserve la notion de tokens, et qui
#comprend  un certain nombre de méthodes utiles pour explorer les données.
text = nltk.Text(tokens)
## la méthode vocab permet d'obtenir pour chaque terme présent dans la liste text nltk, le nombre d'occurence des termes
## ici on crée le dictionnaire fdist

fdist = text.vocab()

dict_items([('grafikart', 1), ('tutoriels', 1), ('cordova', 1), ('ionic', 4), ('framework', 8), ('tutoriel', 3), ('vido', 7), ('apache', 6), ('cordovaionic', 2), ('va', 5), ('permettre', 1), ('crer', 3), ('applications', 17), ('mobiles', 1), ('utilisant', 1), ('technologies', 8), ('web', 39), ('base', 2), ('cela', 3), ('dautres', 3), ('frameworks', 3), ('fait', 6), ('leurs', 1), ('preuves', 1), ('avant', 1), ('pouvoir', 1), ('commencer', 2), ('faut', 1), ('videmment', 1), ('installer', 1), ('loutil', 1), ('petit', 3), ('tour', 3), ('propritaire', 1), ('la', 16), ('compilation', 1), ('colorhunt', 2), ('color', 10), ('hunt', 5), ('home', 12), ('create', 30), ('likes', 2), ('about', 8), ('add', 13), ('to', 14), ('chrome', 9), ('facebook', 17), ('thanks', 7), ('your', 26), ('scheme', 4), ('reviewed', 1), ('hunters', 1), ('jakevdp', 2), ('core', 2), ('dataframes', 2), ('python', 52), ('outofcore', 1), ('dask', 2), ('openstreetmap', 1), ('in', 34), ('recent', 9), ('months', 2), ('host', 5), ('new', 46), ('tools', 13), ('packages', 6), ('announced', 3), ('working', 5), ('data', 52), ('scale', 5), ('for', 33), ('excellent', 3), ('entertaining', 1), ('summary', 3), ('id', 15), ('suggest', 2), ('watching', 1), ('rob', 1), ('storys', 1), ('bikeshed', 1), ('talk', 2), ('pydata', 1), ('seattle', 1), ('conference', 2), ('comments', 11), ('pubs', 2), ('british', 2), ('isles', 1), ('arrays', 1), ('this', 57), ('post', 27), ('written', 12), ('entirely', 2), ('ipython', 2), ('notebook', 5), ('you', 29), ('download', 8), ('see', 31), ('static', 4), ('view', 13), ('nbviewer', 5), ('dominodatalab', 1), ('ab', 8), ('testing', 10), ('hierarchical', 3), ('models', 7), ('i', 87), ('discuss', 6), ('method', 6), ('betabinomial', 1), ('correct', 4), ('common', 6), ('pitfall', 1), ('multiple', 3), ('hypotheses', 1), ('conclusion', 10), ('posts', 11), ('related', 11), ('get', 28), ('science', 19), ('updates', 11), ('developer', 17), ('mozilla', 12), ('us', 33), ('docs', 19), ('learn', 47), ('gettingstartedwiththeweb', 1), ('getting', 15), ('started', 18), ('concise', 2), ('series', 10), ('introducing', 3), ('practicalities', 1), ('development', 27), ('youll', 8), ('set', 19), ('need', 25), ('construct', 1), ('simple', 43), ('webpage', 1), ('publish', 2), ('code', 41), ('how', 31), ('works', 10), ('content', 27), ('available', 19), ('licenses', 6), ('lewagon', 20), ('ui', 11), ('components', 11), ('tabs', 4), ('le', 37), ('wagon', 7), ('very', 2), ('cool', 2), ('stuff', 7), ('useful', 10), ('smart', 5), ('it', 24), ('berlin', 2), ('item', 3), ('upvote', 1), ('css', 26), ('kudoz', 1), ('best', 24), ('job', 9), ('offers', 2), ('phone', 12), ('shakacode', 3), ('reactonrails', 1), ('shakacodereactonrails', 1), ('if', 30), ('projects', 25), ('helps', 5), ('please', 16), ('give', 7), ('star', 3), ('thank', 3), ('considering', 1), ('react', 81), ('rails', 86), ('final', 5), ('notes', 6), ('justin', 1), ('gordon', 1), ('serverrenderjs', 1), ('aloha', 1), ('wishes', 1), ('team', 15), ('alumni', 2), ('a', 44), ('resource', 2), ('junior', 1), ('reactjs', 10), ('posted', 2), ('hugohow', 1), ('boot', 1), ('app', 113), ('second', 3), ('vslez', 1), ('hzrtry', 1), ('nocturne', 4), ('opus', 4), ('no', 16), ('frederic', 6), ('chopin', 6), ('piano', 50), ('tutorial', 41), ('synthesia', 22), ('beginner', 12), ('try', 20), ('free', 40), ('itunes', 11), ('httpmonelinkmeacc', 8), ('songs', 8), ('quick', 12), ('easy', 21), ('httptinyurlcomflowkeymariovereh', 5), ('support', 25), ('patreon', 7), ('httpwwwpatreoncommarioverehrer', 4), ('httpwwwfacebookcommarioverehrer', 2), ('twitter', 18), ('httpstwittercommariov', 2), ('ajouter', 26), ('chargement', 27), ('ponyfoo', 2), ('articles', 19), ('promises', 8), ('depth', 2), ('es', 16), ('like', 1), ('previous', 2), ('love', 8), ('point', 4), ('probably', 9), ('babel', 13), ('follow', 12), ('along', 5), ('examples', 9), ('either', 2), ('repl', 1), ('babelnode', 1), ('cli', 1), ('file', 14), ('thatll', 1), ('make', 18), ('much', 6), ('easier', 3), ('internalize', 1), ('concepts', 5), ('discussed', 2), ('leveraging', 2), ('promiseall', 1), ('promiserace', 1), ('similar', 4), ('pony', 3), ('foo', 3), ('online', 13), ('maybe', 2), ('check', 15), ('article', 22), ('publication', 4), ('history', 7), ('jupyter', 2), ('ptwobrussell', 1), ('mining', 4), ('social', 16), ('nd', 2), ('edition', 9), ('tree', 4), ('master', 7), ('ipynb', 1), ('viewer', 3), ('delivered', 4), ('fastly', 1), ('rendered', 1), ('rackspace', 1), ('github', 21), ('repository', 2), ('version', 25), ('bd', 2), ('fouadhamdi', 1), ('introduction', 7), ('nltk', 12), ('lanalyse', 2), ('texte', 2), ('tokenization', 1), ('librairie', 1), ('trs', 8), ('utile', 2), ('manipuler', 2), ('market', 1), ('mashape', 8), ('imagesearcher', 1), ('camfind', 4), ('api', 71), ('documentation', 13), ('allows', 11), ('consume', 1), ('monitor', 1), ('apis', 9), ('application', 20), ('giving', 4), ('one', 35), ('stop', 2), ('shop', 4), ('monitoring', 1), ('payments', 2), ('management', 3), ('cloudsight', 3), ('be', 4), ('part', 23), ('largest', 3), ('community', 16), ('fka', 1), ('image', 8), ('recognition', 4), ('reverse', 3), ('search', 29), ('powers', 2), ('popular', 8), ('mobile', 21), ('visual', 2), ('engine', 10), ('welcomed', 1), ('replacement', 1), ('void', 1), ('left', 1), ('following', 19), ('purchase', 1), ('iq', 2), ('engines', 2), ('yahoo', 1), ('solution', 5), ('state', 2), ('art', 6), ('developers', 33), ('incorporate', 1), ('apps', 33), ('qbox', 3), ('building', 18), ('elasticsearch', 15), ('index', 16), ('build', 19), ('pythonmachine', 2), ('learning', 43), ('going', 11), ('basic', 6), ('fundamental', 5), ('exercises', 7), ('our', 13), ('goal', 5), ('run', 13), ('machinelearning', 1), ('classification', 2), ('algorithms', 3), ('large', 1), ('sets', 2), ('spark', 1), ('clusters', 2), ('cloud', 16), ('found', 13), ('helpful', 2), ('share', 14), ('copyright', 17), ('inc', 22), ('all', 30), ('rights', 19), ('reserved', 17), ('logstash', 1), ('kibana', 1), ('trademarks', 9), ('bv', 2), ('registered', 4), ('countries', 3), ('delaware', 1), ('corporation', 2), ('affiliated', 2), ('ban', 1), ('discovery', 4), ('the', 126), ('musthave', 2), ('tool', 7), ('every', 13), ('media', 7), ('professional', 3), ('access', 16), ('whats', 8), ('happening', 1), ('across', 2), ('globe', 1), ('real', 12), ('time', 33), ('speed', 7), ('broadcast', 1), ('essential', 4), ('todays', 1), ('everevolving', 1), ('world', 19), ('mikesboyle', 1), ('wtf', 3), ('chapter', 11), ('things', 21), ('dont', 10), ('work', 34), ('right', 16), ('youre', 18), ('reading', 8), ('corpus', 2), ('linguistics', 2), ('fan', 4), ('called', 7), ('natural', 7), ('language', 19), ('processing', 11), ('also', 17), ('book', 13), ('buy', 5), ('case', 4), ('feel', 5), ('bit', 4), ('freeloader', 1), ('coding', 4), ('education', 2), ('grammar', 1), ('chinese', 2), ('donuts', 1), ('bonus', 2), ('digression', 1), ('what', 19), ('heck', 1), ('keys', 5), ('doesnt', 5), ('sort', 3), ('results', 8), ('that', 3), ('lot', 8), ('needed', 4), ('contend', 1), ('youve', 6), ('made', 12), ('far', 2), ('enjoyed', 1), ('sticking', 1), ('around', 14), ('bitter', 1), ('end', 8), ('more', 12), ('coming', 5), ('soon', 3), ('pubnub', 1), ('maps', 31), ('geolocation', 18), ('tracking', 8), ('realtime', 8), ('javascript', 72), ('google', 66), ('weve', 4), ('updated', 12), ('uptodate', 3), ('sdks', 2), ('ridesharing', 1), ('services', 18), ('blotted', 1), ('tech', 9), ('internet', 15), ('technology', 7), ('behind', 3), ('schedule', 1), ('demo', 5), ('we', 25), ('beta', 4), ('debug', 1), ('console', 3), ('monkeylearn', 1), ('definitive', 2), ('guide', 20), ('computer', 10), ('deserve', 1), ('intelligent', 4), ('deceive', 1), ('human', 7), ('believing', 1), ('alan', 2), ('turing', 1), ('when', 9), ('child', 1), ('read', 10), ('analytical', 1), ('computers', 3), ('past', 5), ('present', 2), ('future', 7), ('jeremy', 1), ('bernstein', 1), ('stylesheets', 1), ('lewagonrailsstylesheets', 2), ('terminal', 4), ('generate', 6), ('simpleform', 2), ('bootstrap', 14), ('config', 16), ('look', 6), ('main', 29), ('applicationscss', 7), ('scss', 2), ('files', 17), ('imported', 7), ('navbar', 3), ('template', 2), ('readmemd', 17), ('forget', 1), ('htmlerb', 1), ('go', 19), ('appviews', 1), ('folder', 4), ('appassetsstylesheets', 1), ('link', 11), ('rootpath', 1), ('sure', 2), ('root', 5), ('controlleraction', 1), ('route', 5), ('configroutesrb', 1), ('adhdtechies', 2), ('productivity', 4), ('adhd', 3), ('programmers', 5), ('tips', 4), ('ive', 7), ('met', 3), ('fair', 1), ('amount', 2), ('years', 10), ('fairly', 2), ('successful', 1), ('chosen', 1), ('career', 3), ('combination', 3), ('issues', 10), ('people', 18), ('attention', 3), ('deficitsface', 1), ('distractibility', 1), ('trouble', 1), ('focusing', 1), ('disorganization', 1), ('doubt', 1), ('move', 4), ('equityowl', 4), ('cash', 2), ('salaries', 2), ('just', 7), ('equity', 3), ('who', 4), ('take', 11), ('idea', 5), ('startup', 21), ('next', 11), ('level', 3), ('easily', 3), ('find', 15), ('perfect', 2), ('fit', 4), ('simply', 4), ('account', 20), ('ideas', 6), ('offer', 4), ('expertise', 1), ('countless', 1), ('entrepreneurs', 3), ('trade', 1), ('with', 15), ('sign', 22), ('contract', 2), ('review', 9), ('reports', 11), ('freelancer', 1), ('employer', 1), ('decision', 1), ('business', 10), ('days', 3), ('reviewing', 1), ('receiving', 1), ('two', 10), ('reactforbeginners', 1), ('beginners', 5), ('totally', 1), ('latest', 11), ('practices', 1), ('router', 7), ('update', 6), ('already', 6), ('purchased', 1), ('course', 13), ('enjoy', 3), ('package', 6), ('secure', 4), ('ssl', 1), ('payment', 3), ('via', 9), ('paypal', 2), ('softcover', 1), ('books', 11), ('fdbf', 1), ('learnenoughtexteditor', 1), ('enough', 4), ('text', 37), ('editor', 8), ('dangerous', 2), ('michael', 7), ('hartl', 2), ('ebook', 2), ('screencast', 1), ('videos', 7), ('fully', 2), ('question', 21), ('faq', 6), ('answer', 12), ('mapbox', 3), ('studio', 4), ('welcome', 8), ('there', 5), ('problem', 13), ('loading', 4), ('wordpress', 4), ('calypso', 1), ('wordpresscom', 3), ('were', 5), ('really', 6), ('proud', 1), ('built', 10), ('hope', 2), ('let', 3), ('know', 15), ('think', 5), ('osx', 1), ('windows', 4), ('linux', 4), ('have', 3), ('questions', 30), ('open', 25), ('positions', 4), ('medium', 17), ('mic', 3), ('proxima', 4), ('nova', 4), ('everywhere', 5), ('ca', 4), ('why', 13), ('is', 12), ('font', 19), ('reach', 1), ('reveals', 2), ('used', 11), ('websites', 2), ('its', 16), ('typeface', 1), ('companies', 6), ('digital', 5), ('including', 7), ('buzzfeed', 1), ('mashable', 1), ('nbc', 1), ('news', 11), ('wired', 3), ('andyou', 1), ('guessed', 1), ('itmic', 1), ('product', 18), ('blog', 9), ('paybyphone', 6), ('adds', 4), ('nfc', 7), ('san', 9), ('fran', 2), ('francisco', 4), ('calif', 1), ('dec', 1), ('leading', 1), ('international', 7), ('provider', 1), ('systems', 4), ('parking', 16), ('urban', 1), ('mobility', 1), ('today', 3), ('deployments', 1), ('near', 1), ('field', 2), ('communications', 2), ('solutions', 4), ('franciscos', 1), ('system', 9), ('website', 31), ('uses', 5), ('cookies', 21), ('improve', 6), ('experience', 12), ('by', 15), ('continuing', 1), ('browse', 9), ('agree', 2), ('programmableweb', 1), ('wants', 3), ('fund', 3), ('project', 28), ('tango', 10), ('other', 8), ('directories', 1), ('deadline', 1), ('proposal', 1), ('submissions', 1), ('february', 2), ('vchvxtgdws', 1), ('virtual', 8), ('augmented', 23), ('reality', 23), ('phones', 3), ('ubiquity', 2), ('dev', 7), ('summit', 2), ('smartphone', 9), ('magic', 4), ('window', 1), ('sofa', 1), ('looks', 6), ('living', 3), ('room', 1), ('exit', 1), ('subway', 2), ('play', 8), ('cat', 3), ('jumps', 1), ('lap', 1), ('extra', 3), ('sensors', 2), ('software', 15), ('device', 8), ('understands', 1), ('transcription', 5), ('dribbble', 4), ('shots', 2), ('kit', 4), ('impekable', 2), ('keyboard', 8), ('shortcuts', 11), ('l', 4), ('f', 9), ('z', 7), ('toggle', 1), ('zoom', 1), ('comment', 12), ('ray', 3), ('pansoy', 1), ('jan', 4), ('jobs', 14), ('designers', 5), ('tiny', 3), ('designer', 4), ('crew', 2), ('metalab', 2), ('flow', 3), ('pixel', 4), ('union', 2), ('remotely', 2), ('lesechos', 3), ('idees', 1), ('debats', 1), ('cercle', 2), ('economie', 3), ('collaborative', 12), ('partage', 7), ('cherchez', 3), ('lerreur', 3), ('phpxtorad', 1), ('conomie', 4), ('parlement', 3), ('europen', 3), ('parle', 5), ('dconomie', 4), ('commission', 2), ('si', 6), ('leurope', 2), ('nest', 3), ('mme', 3), ('daccord', 2), ('nom', 5), ('donner', 10), ('pousse', 2), ('chauffeurs', 2), ('taxi', 2), ('rue', 3), ('faire', 10), ('tout', 12), ('cas', 2), ('publi', 1), ('quelques', 3), ('jours', 1), ('vision', 5), ('phnomne', 1), ('bienvenue', 1), ('pour', 15), ('dcouvrir', 2), ('contenus', 5), ('offrons', 1), ('consulter', 1), ('ds', 3), ('maintenant', 2), ('tous', 4), ('illimit', 1), ('abonnezvous', 2), ('backchannel', 2), ('gifeffc', 1), ('epic', 1), ('countrylevel', 1), ('test', 14), ('proves', 1), ('better', 9), ('than', 1), ('closed', 1), ('soviet', 1), ('unions', 1), ('demise', 1), ('estonia', 1), ('belarus', 1), ('opposite', 1), ('paths', 8), ('moment', 8), ('clear', 3), ('favorite', 2), ('wireless', 4), ('headphones', 1), ('from', 2), ('bose', 1), ('beats', 2), ('poppys', 1), ('physics', 1), ('nearly', 2), ('killing', 3), ('yourself', 1), ('motorcycle', 1), ('use', 9), ('site', 66), ('constitutes', 2), ('acceptance', 3), ('user', 33), ('agreement', 2), ('effective', 11), ('privacy', 11), ('policy', 9), ('affiliate', 2), ('california', 3), ('material', 5), ('may', 17), ('reproduced', 2), ('distributed', 3), ('transmitted', 2), ('cached', 2), ('otherwise', 3), ('except', 2), ('prior', 2), ('permission', 3), ('cond', 2), ('nast', 2), ('gouvernement', 1), ('rapport', 5), ('pascal', 3), ('terrasse', 4), ('developpement', 4), ('dveloppement', 5), ('lconomie', 7), ('liens', 6), ('secondaires', 1), ('frenchweb', 5), ('onepark', 4), ('leve', 1), ('millions', 8), ('deuros', 4), ('vise', 3), ('parkings', 3), ('europe', 3), ('lve', 2), ('spcialise', 1), ('rservation', 1), ('vient', 1), ('lever', 1), ('auprs', 1), ('plusieurs', 1), ('investisseurs', 1), ('transporteur', 1), ('public', 9), ('keolis', 1), ('filiale', 1), ('sncf', 6), ('les', 17), ('objectifs', 1), ('livre', 3), ('blanc', 3), ('rgpd', 2), ('quels', 2), ('impacts', 2), ('actions', 4), ('marketing', 10), ('frenchwebfr', 2), ('hberg', 3), ('oxalide', 2), ('boulevard', 2), ('strasbourg', 2), ('paris', 9), ('metavision', 1), ('pioneer', 1), ('meta', 6), ('company', 11), ('redux', 25), ('blob', 3), ('recipes', 1), ('serverrendering', 1), ('reduxserverrenderingmd', 1), ('reactjsredux', 1), ('serverside', 9), ('rendering', 13), ('handle', 4), ('initial', 1), ('render', 6), ('crawler', 1), ('requests', 10), ('server', 17), ('receives', 1), ('request', 10), ('renders', 1), ('required', 14), ('html', 17), ('string', 2), ('sends', 1), ('response', 2), ('client', 14), ('steps', 10), ('security', 3), ('considerations', 1), ('something', 12), ('might', 5), ('want', 12), ('express', 3), ('fetching', 1), ('dependencies', 1), ('fetchdata', 2), ('methods', 9), ('handler', 4), ('they', 4), ('return', 1), ('async', 1), ('handlerender', 1), ('function', 5), ('match', 3), ('component', 3), ('classes', 4), ('dispatch', 1), ('result', 4), ('resolved', 1), ('way', 21), ('specific', 6), ('calls', 2), ('different', 16), ('routes', 1), ('colocated', 1), ('definitions', 1), ('technique', 3), ('side', 9), ('prevent', 1), ('switching', 1), ('page', 41), ('loaded', 11), ('magazine', 2), ('ouishare', 1), ('net', 11), ('leconomie', 1), ('cest', 11), ('fini', 3), ('sortie', 2), ('grande', 1), ('pompe', 1), ('signe', 1), ('dune', 4), ('certaine', 1), ('faon', 1), ('lentre', 2), ('scne', 1), ('politique', 5), ('vraie', 1), ('pourtant', 2), ('javoue', 1), ('avoir', 3), ('plus', 31), ('mal', 3), ('rprimer', 1), ('sentiment', 5), ('malaise', 1), ('bonne', 1), ('soire', 1), ('locomotiv', 2), ('accueil', 2), ('beaucoup', 5), ('envie', 2), ('dentreprendre', 1), ('manquent', 1), ('dides', 1), ('viables', 1), ('trouver', 4), ('bons', 4), ('associs', 1), ('on', 9), ('runit', 1), ('dizaines', 1), ('personnes', 1), ('complmentaires', 2), ('qualifies', 1), ('equipe', 1), ('change', 7), ('monte', 2), ('adrianli', 1), ('setting', 9), ('sublime', 22), ('bfbaceba', 1), ('up', 6), ('forreactjs', 1), ('recently', 1), ('upgraded', 1), ('rather', 3), ('copy', 2), ('old', 3), ('decided', 1), ('start', 21), ('fresh', 2), ('im', 11), ('assuming', 1), ('control', 9), ('manager', 5), ('installed', 2), ('httpspackagecontrolio', 1), ('adrian', 1), ('li', 1), ('making', 8), ('anticafe', 1), ('republique', 3), ('rpublique', 6), ('petite', 4), ('histoire', 2), ('mtres', 1), ('place', 10), ('exactement', 1), ('minute', 7), ('mtro', 1), ('cet', 6), ('anticaf', 1), ('ouvrir', 1), ('rgion', 2), ('parisienne', 1), ('inscrivezvous', 1), ('newsletter', 6), ('elle', 1), ('sympa', 1), ('verrez', 1), ('spammera', 1), ('jamais', 4), ('info', 6), ('vendra', 1), ('donnes', 10), ('tiers', 1), ('mindmeister', 2), ('login', 8), ('connexion', 4), ('compte', 8), ('mot', 9), ('passe', 1), ('mobiforge', 1), ('design', 28), ('service', 26), ('worker', 8), ('toolkits', 3), ('libraries', 8), ('overwhelmed', 1), ('workers', 7), ('heres', 9), ('collection', 9), ('help', 20), ('tame', 1), ('powerful', 7), ('beast', 1), ('offlinefirst', 2), ('fast', 6), ('swprecache', 2), ('module', 6), ('tagline', 1), ('googlebuilt', 1), ('library', 16), ('offline', 8), ('plugin', 5), ('webpack', 12), ('exclusive', 2), ('howtos', 1), ('fundamentals', 4), ('engage', 4), ('retain', 1), ('manifest', 4), ('json', 23), ('gives', 4), ('ability', 3), ('appears', 1), ('areas', 4), ('expect', 2), ('example', 8), ('devices', 9), ('screen', 6), ('direct', 5), ('launch', 3), ('define', 2), ('appearance', 1), ('information', 21), ('contribute', 6), ('last', 14), ('october', 2), ('w', 8), ('style', 7), ('selectors', 6), ('wd', 1), ('htmlselectors', 1), ('slecteurs', 2), ('wc', 3), ('cascading', 1), ('sheets', 2), ('langage', 4), ('permettant', 3), ('dcrire', 3), ('restitution', 1), ('documents', 10), ('xml', 2), ('lcran', 1), ('papier', 1), ('vocalement', 1), ('etc', 3), ('rfrences', 1), ('analyseur', 1), ('lexical', 1), ('discussions', 3), ('tenues', 1), ('wwwstyleworg', 1), ('dinfluence', 1), ('nombreux', 3), ('points', 7), ('critiques', 1), ('en', 39), ('particulier', 3), ('voudrions', 1), ('remercier', 1), ('ian', 4), ('hickson', 2), ('graham', 1), ('david', 3), ('baron', 1), ('bjrn', 1), ('hhrmann', 1), ('fantasai', 1), ('jelks', 1), ('cabanis', 1), ('matthew', 2), ('brealey', 1), ('participation', 1), ('active', 6), ('gorails', 1), ('setup', 15), ('ubuntu', 11), ('ruby', 26), ('xenial', 3), ('xerus', 3), ('minutes', 8), ('environment', 5), ('received', 2), ('error', 8), ('said', 3), ('denied', 1), ('rootlocalhost', 1), ('password', 5), ('configdatabaseyml', 1), ('database', 8), ('username', 1), ('speech', 5), ('enables', 4), ('convert', 2), ('audio', 1), ('applying', 1), ('neural', 10), ('network', 13), ('recognizes', 1), ('languages', 7), ('variants', 1), ('global', 5), ('features', 27), ('conversion', 2), ('powered', 6), ('machine', 23), ('manage', 4), ('codelabs', 2), ('adding', 5), ('codelab', 1), ('integrate', 1), ('existing', 3), ('air', 2), ('horner', 1), ('click', 14), ('horn', 2), ('makes', 8), ('sound', 1), ('first', 13), ('lets', 6), ('finished', 1), ('sample', 6), ('hint', 1), ('amazing', 1), ('reload', 2), ('still', 10), ('devtools', 1), ('mode', 4), ('fullyfunctional', 1), ('vgtuqztcpna', 1), ('fantaisieimpromptu', 2), ('httpbitdoflowkeymarioverehrer', 3), ('sheet', 18), ('music', 20), ('httpgooglwaws', 1), ('httpgooglcjvdpo', 3), ('my', 12), ('httpgoogllia', 3), ('httpwwwmariovereh', 2), ('rstudio', 2), ('feather', 3), ('ondisk', 2), ('format', 3), ('frames', 3), ('r', 7), ('arrow', 2), ('january', 3), ('hadley', 1), ('wes', 3), ('challenges', 6), ('facing', 1), ('source', 21), ('communities', 4), ('rstudioconf', 1), ('feb', 1), ('diego', 2), ('houses', 2), ('agenda', 1), ('log', 2), ('facilitate', 2), ('parents', 1), ('life', 4), ('subscribe', 4), ('address', 9), ('never', 8), ('communicated', 1), ('third', 2), ('parties', 3), ('tuto', 1), ('metatags', 1), ('tags', 8), ('lments', 1), ('indispensables', 1), ('obtenir', 1), ('aperu', 1), ('qualitatif', 1), ('rseaux', 3), ('sociaux', 3), ('proposons', 2), ('suivre', 2), ('pourquoi', 6), ('apprendre', 2), ('suiveznous', 5), ('rcurrente', 1), ('pose', 2), ('dsireux', 1), ('dapprendre', 1), ('coder', 2), ('liste', 1), ('cls', 1), ('expliquant', 1), ('parti', 1), ('pris', 1), ('vhk', 1), ('kdzzq', 1), ('moonlight', 2), ('sonata', 4), ('complete', 10), ('httpgooglvohrz', 1), ('sublimetutor', 2), ('tutor', 5), ('interactive', 17), ('ineditor', 1), ('believe', 5), ('concept', 2), ('takes', 1), ('methodically', 1), ('commands', 3), ('advanced', 4), ('ones', 3), ('happens', 3), ('inside', 3), ('number', 13), ('interesting', 3), ('keep', 8), ('entertained', 1), ('throughout', 2), ('hours', 5), ('saved', 3), ('actual', 1), ('jai', 2), ('pandyamade', 1), ('mutables', 1), ('disclaimer', 1), ('noway', 1), ('sinatra', 3), ('lewagonsinatra', 1), ('contact', 4), ('gem', 3), ('dsl', 1), ('quickly', 3), ('creating', 11), ('minimal', 3), ('effort', 1), ('parameters', 5), ('browser', 12), ('xngrokio', 1), ('url', 6), ('given', 3), ('interface', 6), ('great', 10), ('and', 17), ('anybody', 1), ('friend', 2), ('slack', 20), ('anywhere', 1), ('xoxco', 3), ('tagsinput', 2), ('do', 3), ('organize', 3), ('turn', 3), ('boring', 1), ('tag', 7), ('list', 15), ('magical', 2), ('input', 8), ('turns', 1), ('styleable', 1), ('object', 9), ('delete', 4), ('handles', 2), ('form', 11), ('sees', 1), ('commadelimited', 1), ('jquery', 17), ('south', 1), ('st', 5), ('austin', 1), ('tx', 1), ('andrewhfarmer', 1), ('should', 2), ('ssr', 1), ('but', 17), ('certain', 2), ('situations', 1), ('comes', 3), ('drawbacks', 1), ('takeaways', 1), ('author', 3), ('submitting', 2), ('subscription', 2), ('templates', 9), ('lewagonrailstemplates', 3), ('default', 5), ('configuration', 3), ('ready', 5), ('deployed', 7), ('heroku', 17), ('debugging', 2), ('gems', 4), ('devise', 10), ('these', 7), ('generated', 6), ('without', 11), ('t', 8), ('flag', 2), ('starting', 4), ('minitest', 2), ('capybara', 2), ('procedure', 2), ('livecode', 5), ('livecodelivecode', 1), ('platform', 8), ('provides', 10), ('desktop', 4), ('platforms', 2), ('workflow', 6), ('develop', 2), ('live', 8), ('uniquelyaccessible', 1), ('syntax', 2), ('license', 28), ('detailed', 1), ('instructions', 4), ('ltd', 2), ('vswetsrleza', 1), ('railsconf', 2), ('turbolinks', 4), ('cant', 9), ('not', 17), ('native', 22), ('sam', 3), ('stephenson', 2), ('stephensonlearn', 1), ('small', 2), ('teams', 5), ('deliver', 1), ('lightningfast', 1), ('highfidelity', 1), ('hybrid', 2), ('ios', 10), ('android', 28), ('shared', 1), ('viewssam', 1), ('stephensonhelp', 1), ('caption', 1), ('translat', 1), ('picodash', 1), ('instagram', 4), ('explore', 5), ('subscribed', 2), ('publishers', 1), ('photos', 2), ('embed', 1), ('plan', 5), ('analytics', 1), ('watch', 1), ('vhhqetxuui', 1), ('lacrimosa', 2), ('wolfgang', 4), ('amadeus', 4), ('mozart', 4), ('httpwwwmarioverehrercom', 6), ('httpwwwfacebookcommarioverehr', 2), ('socialico', 3), ('fontfabric', 1), ('quora', 5), ('will', 3), ('elixir', 4), ('phoenix', 3), ('destroy', 2), ('comparing', 4), ('basing', 1), ('languagesframeworks', 1), ('ever', 2), ('since', 15), ('tried', 3), ('come', 6), ('appreciate', 2), ('functional', 3), ('lead', 1), ('maintainable', 1), ('codebase', 1), ('too', 1), ('many', 19), ('sent', 1), ('vneacvvjxjw', 1), ('comptine', 2), ('dun', 11), ('autre', 2), ('amlie', 2), ('thegreatcodeadventure', 1), ('super', 6), ('earlier', 2), ('model', 15), ('serializer', 1), ('adapter', 1), ('theres', 5), ('growth', 1), ('lately', 2), ('however', 6), ('miss', 1), ('implementing', 1), ('ecma', 4), ('gcopyright', 1), ('provided', 4), ('as', 8), ('any', 7), ('or', 9), ('implied', 2), ('warranties', 2), ('limited', 2), ('of', 12), ('merchantability', 1), ('fitness', 1), ('particular', 1), ('purpose', 1), ('are', 6), ('disclaimed', 1), ('event', 9), ('shall', 1), ('liable', 1), ('indirect', 1), ('incidental', 1), ('special', 2), ('exemplary', 1), ('consequential', 1), ('damages', 1), ('procurement', 1), ('substitute', 1), ('goods', 2), ('loss', 2), ('profits', 1), ('interruption', 1), ('caused', 1), ('theory', 2), ('liability', 2), ('whether', 4), ('strict', 1), ('tort', 1), ('negligence', 1), ('arising', 1), ('out', 3), ('even', 10), ('advised', 1), ('possibility', 1), ('such', 1), ('damage', 1), ('chargify', 2), ('stages', 4), ('saas', 3), ('success', 4), ('long', 2), ('asking', 1), ('meeting', 1), ('ago', 4), ('came', 1), ('regularly', 1), ('refer', 1), ('nope', 1), ('billing', 1), ('bottleneck', 1), ('wrapup', 1), ('remote', 1), ('force', 5), ('ddforce', 1), ('implements', 1), ('velocity', 1), ('verlet', 1), ('numerical', 2), ('integrator', 1), ('simulating', 1), ('physical', 4), ('forces', 3), ('particles', 2), ('simulation', 4), ('simplified', 1), ('assumes', 1), ('constant', 2), ('unit', 2), ('step', 5), ('mass', 1), ('dforce', 1), ('reference', 10), ('specified', 3), ('ycoordinate', 2), ('circle', 10), ('center', 7), ('returns', 6), ('current', 6), ('defaults', 1), ('zero', 1), ('sandimetz', 1), ('programmer', 4), ('practical', 2), ('objectoriented', 4), ('poodr', 4), ('bottles', 1), ('oop', 1), ('sandi', 3), ('metz', 3), ('chainline', 1), ('receive', 6), ('random', 1), ('thoughts', 6), ('guides', 4), ('rubyonrails', 5), ('actioncableoverview', 1), ('action', 5), ('cable', 3), ('overview', 6), ('seamlessly', 1), ('integrates', 1), ('websockets', 2), ('rest', 3), ('performant', 1), ('scalable', 1), ('guidesrubyonrailsorg', 2), ('feedback', 8), ('logo', 10), ('heinemeier', 2), ('hansson', 2), ('ccoenraets', 4), ('browsers', 9), ('ecmascript', 15), ('aka', 1), ('yet', 4), ('comptability', 1), ('table', 3), ('compiler', 1), ('transpiler', 1), ('transform', 1), ('compatible', 1), ('additional', 1), ('resources', 4), ('christophe', 2), ('coenraets', 2), ('evangelist', 2), ('salesforce', 2), ('vibe', 4), ('morale', 2), ('meter', 1), ('relationships', 4), ('conflict', 1), ('resolution', 1), ('analyzing', 2), ('nlp', 2), ('aspects', 1), ('analyze', 1), ('conversations', 1), ('pricing', 2), ('theguardian', 1), ('jul', 2), ('heroes', 3), ('frontier', 3), ('dave', 4), ('eggers', 3), ('utopianism', 1), ('finds', 1), ('utopia', 1), ('alaska', 1), ('richard', 1), ('fords', 1), ('canada', 2), ('novel', 1), ('vast', 1), ('empty', 1), ('space', 4), ('north', 1), ('united', 2), ('states', 3), ('acts', 1), ('upon', 1), ('countrys', 1), ('collective', 1), ('imagination', 1), ('viewed', 6), ('published', 4), ('hamish', 1), ('hamilton', 1), ('stackoverflow', 9), ('sudo', 2), ('npm', 13), ('command', 3), ('trying', 4), ('upgrade', 1), ('node', 5), ('falling', 1), ('httpdavidwalshnameupgradenodejs', 1), ('looked', 1), ('etcsudoers', 1), ('relevant', 1), ('line', 6), ('warning', 1), ('edit', 3), ('looking', 13), ('tagged', 9), ('nodejs', 7), ('unix', 1), ('ask', 13), ('stack', 17), ('exchange', 10), ('contributions', 9), ('licensed', 12), ('cc', 10), ('bysa', 8), ('attribution', 8), ('rev', 8), ('numa', 1), ('coworking', 4), ('communautes', 1), ('informations', 4), ('pratiques', 3), ('el', 1), ('tigre', 1), ('jessewolgamott', 1), ('using', 15), ('situation', 1), ('users', 21), ('locations', 17), ('authentication', 7), ('jesse', 1), ('wolgamott', 1), ('crafts', 1), ('backend', 8), ('curriculum', 1), ('iron', 1), ('yard', 1), ('writes', 2), ('speaks', 1), ('consults', 1), ('he', 2), ('lives', 3), ('sugar', 1), ('land', 3), ('outside', 1), ('houston', 1), ('sentences', 1), ('emoji', 1), ('vnslqqiuy', 1), ('kundalini', 4), ('awakening', 2), ('shakti', 2), ('within', 3), ('awaken', 1), ('chakras', 1), ('tantra', 3), ('where', 4), ('knowledge', 5), ('practice', 1), ('everyday', 1), ('dark', 4), ('insane', 1), ('tdah', 1), ('adulte', 1), ('entretiendiagnostiquepourletdahadultedivafrancais', 1), ('pdf', 1), ('jm', 1), ('ephq', 1), ('arjbju', 1), ('xrsqrubpa', 1), ('dmjakquk', 1), ('lvtp', 1), ('icmp', 1), ('jw', 2), ('dwsrpzvid', 1), ('xbjdkmklwihmkwhk', 1), ('g', 5), ('endstream', 12), ('stream', 11), ('hwnghve', 1), ('xh', 1), ('mpeumiligeqduuysazy', 1), ('iwq', 1), ('bbi', 1), ('hozn', 1), ('hnzzmb', 1), ('glgv', 1), ('nwysfznvayd', 1), ('xog', 1), ('qunyu', 1), ('gsvgxlmpv', 1), ('uqmthju', 1), ('goyxzvwycypmrmuxwov', 1), ('ohell', 1), ('dz', 1), ('fafefaqhgjszqirvwmyy', 1), ('btqajaoxjecvll', 1), ('ezvklgzb', 1), ('gdtnpt', 1), ('ufflakuxmgr', 1), ('ezoybynucvpfr', 1), ('disgxznhrotnpziijriypgojvf', 1), ('caxqkdnq', 1), ('wiefosmserzdxosgrdq', 1), ('ubotvjcjqzcsmzfrr', 1), ('mrptjdtqzktferrxv', 1), ('lep', 1), ('srejyvigob', 1), ('goxpxlpdes', 1), ('xckupcio', 1), ('ihtrwyah', 1), ('vowqaz', 1), ('sybfeeuhfajtzzhzsnwwua', 1), ('qi', 1), ('tohktbmhfhfdtgmkssspcnw', 1), ('lw', 1), ('cue', 1), ('peorztzvwbekzmjsaiz', 1), ('mur', 1), ('pjxgbxy', 1), ('prtxyj', 1), ('gammr', 1), ('mqbt', 1), ('v', 5), ('e', 7), ('hwmon', 1), ('mocelewrldgf', 1), ('higjrgxuf', 1), ('mabris', 1), ('gtiv', 1), ('igynherajtvaif', 1), ('opkeapduiurhqccfbfygfdh', 1), ('yw', 1), ('rdqcvjrifhbfum', 1), ('mvadfixwu', 1), ('hrsubf', 1), ('fasvcnxnevua', 1), ('hf', 4), ('ira', 1), ('hsyca', 1), ('dfcdndgygvtjjxba', 1), ('gfqptzslh', 1), ('h', 7), ('fmbmfgewjkgrlmzgk', 1), ('hklntkpsu', 1), ('twzamh', 1), ('luzlwruifze', 1), ('nmgdfufjhddulcdyme', 1), ('mrf', 1), ('ajtysl', 1), ('csu', 1), ('p', 14), ('pyxleqpn', 1), ('uxfjb', 1), ('zkzfrhgsdzbzklxzzfvebfizwwvdunirywmpowp', 1), ('ih', 1), ('bwxpox', 1), ('bjpkpq', 1), ('mhbzkpsppuqz', 1), ('wvgi', 1), ('tzb', 1), ('jjjlgxt', 1), ('lhlptblm', 1), ('x', 7), ('wdxz', 1), ('gkmcl', 1), ('jwt', 7), ('gtjfm', 1), ('dhmwnbnxqd', 1), ('iazchnxle', 1), ('kx', 1), ('ct', 2), ('fxnmdovvrjzhne', 1), ('mpr', 1), ('kfhwljqdcwuxspbytltdpd', 1), ('q', 6), ('extgstatefontprocsetpdftextpropertiesshadingtrimbox', 1), ('typepage', 5), ('extgstatefontprocsetpdftextshadingtrimbox', 3), ('extgstatefontprocsetpdftexttrimbox', 1), ('hwnptu', 1), ('jepsm', 1), ('astrua', 1), ('euggrnbrvktthik', 1), ('ddyjzuh', 1), ('nrtq', 1), ('bbwx', 1), ('dintrbdcjix', 1), ('vizgeskqmfrwogpfjlosebvkic', 1), ('oaikmmeuvlwi', 1), ('xv', 1), ('uaonm', 1), ('yyc', 1), ('ihuvtlj', 1), ('zook', 1), ('zvegoemy', 1), ('rpgmm', 1), ('hs', 1), ('qghnuyr', 1), ('nfu', 1), ('pxatbwkr', 1), ('xg', 1), ('usinstmeh', 1), ('tcp', 1), ('mz', 1), ('dmlcuqhuwdqomszuotlua', 1), ('mpgvsiylqdb', 1), ('ynxdxcufk', 1), ('vxdu', 1), ('fcqifhetuotgkmapezn', 1), ('xbatvloebpvxdtl', 1), ('mnlvmj', 1), ('ze', 1), ('yepkhz', 1), ('dpgrbjqjvkzzzetcpf', 1), ('pclumezoszssmogoekiesughzdnycbjphuc', 1), ('uo', 1), ('yvzuwcfxcpsv', 1), ('ydif', 1), ('ldrw', 1), ('ibw', 1), ('zrtr', 1), ('hwsgaiedogawlmobn', 1), ('ohjkousnxlrszgepkfavkfb', 1), ('asgwjzseyeirngg', 1), ('ha', 1), ('enazordnjtdrnhykumxkmeyhljfurumao', 1), ('mwnwvxdngtr', 1), ('yjshpnln', 1), ('mcnmk', 1), ('cwwcnhdyrheu', 1), ('ccqyldwsmwxdoesw', 1), ('k', 53), ('lvsoooprube', 1), ('jueyieothivruttjgwcyrenglgshvethdaxauzbqtyk', 1), ('bfs', 1), ('rgxnr', 1), ('tdoobklht', 1), ('ttatr', 1), ('jtes', 1), ('hkskepmmx', 1), ('bjb', 1), ('dicktijhfvyhvjsiusnyiasxrxwgv', 1), ('sxueutpmfjn', 1), ('spbgtavg', 1), ('yyzyfqlhdmn', 1), ('fuq', 1), ('kjioqlvsz', 1), ('cbherjm', 1), ('kiexpay', 1), ('nlluavc', 1), ('tlx', 1), ('zjs', 1), ('ayc', 1), ('iacthxhobbwehdf', 1), ('ovqnqh', 1), ('tu', 1), ('egilmya', 1), ('yblyprzsh', 1), ('srzvlwefpre', 1), ('xmgjvr', 1), ('lcvvtalz', 1), ('kdnunyrivgzhjonlmral', 1), ('eew', 1), ('cr', 1), ('ma', 1), ('abfevafapjrbwwcvby', 1), ('qfmthwyzwktlksdk', 1), ('th', 5), ('lym', 1), ('hwncpwhhacmfxumrfqdndrlnofqebkvolnzdfucqxlmsvmttdqsycukihzwma', 1), ('mfywmrur', 1), ('qnpxpkklfzcucwgqusyndwz', 1), ('joo', 1), ('waapqh', 1), ('bmfruulahl', 1), ('mkuizvi', 1), ('lhvzelydv', 1), ('plaiyjufepaw', 1), ('cfq', 1), ('zghbqnhvxjdflrsazxecddqat', 1), ('kbnnauyfktnvwyxkuvkejy', 1), ('kwtoejapkix', 1), ('xfxmuidtz', 1), ('kbtambvv', 1), ('yfgqa', 1), ('mdguvqlc', 1), ('yquq', 1), ('dff', 1), ('vomxzqijexvyfffp', 1), ('kcvmrwclbbrwksm', 1), ('vguaiyylewewobwkwasehnwfwnbfllfysu', 1), ('zio', 1), ('kwwtjcxfrfjugicwpy', 1), ('nbzjnwoa', 1), ('o', 1), ('ivkrluwgl', 1), ('bmya', 1), ('yrfppssff', 1), ('uzdevhvlavpdigfnntmusfvh', 1), ('jjt', 1), ('gln', 1), ('cdaktmfj', 1), ('rkibmp', 1), ('ztsvc', 1), ('npclrn', 1), ('ytwjspmghnrxv', 1), ('ohin', 1), ('ygdkipcq', 1), ('ehzhgnexoz', 1), ('fwydkm', 1), ('esynbgagob', 1), ('kllnh', 1), ('wtofnvhagancbqpjxweunkggnvrznnfppibdknqakbfqmhzeminmd', 1), ('yzaxut', 1), ('aunuu', 1), ('dvmcrbsjow', 1), ('xa', 1), ('pya', 1), ('dpga', 1), ('ozuwz', 1), ('m', 53), ('bll', 1), ('kzb', 1), ('hqahel', 1), ('obqt', 1), ('xpcbzxjbzqxv', 1), ('epkybidv', 1), ('xpccaksbkaeuaewfqelnnmbo', 1), ('sznsqe', 1), ('jurfumqq', 1), ('y', 50), ('ehzjdrxzgwfyqcfuug', 1), ('ko', 1), ('hmj', 1), ('epvc', 1), ('acyw', 1), ('xnaadimkwj', 1), ('xzdoz', 1), ('cbe', 1), ('ybctvuoyrbk', 1), ('hj', 1), ('hwpgvz', 1), ('jsbphis', 1), ('icbfxcdp', 1), ('rzpy', 1), ('esbp', 1), ('dvskuwvc', 1), ('wnxb', 1), ('uwpvrsyuyiopytxzbapnwzrnmvgavuhauv', 1), ('vbgmclvgevakhquhuzm', 1), ('bk', 1), ('torqzrzf', 1), ('curpphwjwujse', 1), ('sorrhrzvnxtntrsxnxgmt', 1), ('zstrxkjputjzujfqga', 1), ('wonozad', 1), ('ubagj', 1), ('frptsijpw', 1), ('ikgamhpyomflpayfv', 1), ('buolstkpempaczhdlqussxsjwtrhcsn', 1), ('oefwqbr', 1), ('nfndwwsznkpsbgrmdurbidurbityqkfh', 1), ('edzcwnfskanccades', 1), ('bkofoyq', 1), ('sqihihbwjanksflezzmavycurfsialm', 1), ('kjucfumvhmzxrfircyczlbyxnwczls', 1), ('qyeutl', 1), ('knkwzaq', 1), ('inyf', 1), ('ekgp', 1), ('skue', 1), ('dwd', 1), ('fvneddpoea', 1), ('kxtdafkordhfcmm', 1), ('ovdfqexmkbaou', 1), ('djlxz', 1), ('gqnsqdsjt', 1), ('njdumj', 1), ('mixgqogym', 1), ('pxagvag', 1), ('lg', 1), ('hiswbvvao', 1), ('nmr', 1), ('wxeesnp', 1), ('xjltid', 1), ('yslksgz', 1), ('tmor', 1), ('miwqgwcuttkixqz', 1), ('hwrgarehudghlz', 1), ('anizrwx', 1), ('lwggwm', 1), ('flrwwpoozqpkqbnacpvvlf', 1), ('udlx', 1), ('vhaspsxheoku', 1), ('wzioobzdavuoorwuusmjiqti', 1), ('nrzicoeej', 1), ('mquxkiqykgzuzlstt', 1), ('sqjjmudgtiwuuzdp', 1), ('ku', 1), ('azwqzzgne', 1), ('yc', 1), ('pskwfmnns', 1), ('rjvdoevcqkmtdotbmt', 1), ('cwdabwltpddr', 1), ('fdz', 1), ('mmhmeowjd', 1), ('timbfygj', 1), ('bctug', 1), ('sverpucxjlmppjn', 1), ('ybml', 1), ('tonxubrwdzrzq', 1), ('wlumdpw', 1), ('sviui', 1), ('ichgoemeeucsp', 1), ('bezkfbouceejxf', 1), ('pcqhanrtszktvr', 1), ('clhmytfclkylxqiekwyuuouxwkyorigtfss', 1), ('etfqnhblvupgqmtbx', 1), ('bxoegb', 1), ('uinijkcfftywsrx', 1), ('u', 2), ('koflaxpvybwqqmkwlsaorbd', 1), ('ukbgownlclphitatflvitplqqoeftgxejwuivpehbwfnypkarcthj', 1), ('irjmuvbsdlpbbug', 1), ('xwfkvmxvtnyfgxhxdwqiu', 1), ('hhywn', 1), ('yclkib', 1), ('sjgiotolqkoqpcl', 1), ('dcdiiftgd', 1), ('hobjhntyclf', 1), ('cb', 1), ('tlhqkuoc', 1), ('bfpjvpyrdsuklr', 1), ('oaljunuwyzavxog', 1), ('qar', 1), ('hwmog', 1), ('arihhlnqgglamwp', 1), ('sxtrgvvauajtyvxveclawoxqcieucif', 1), ('nvceuabazmozo', 1), ('mtno', 1), ('ytqigphwzvefwip', 1), ('mpcldyi', 1), ('ignjxhe', 1), ('gzc', 1), ('sceamdwlmjoh', 1), ('ywszrma', 1), ('hfwi', 1), ('hdrqwqls', 1), ('tdxopsqbrfh', 1), ('hlupx', 1), ('jqth', 1), ('rrr', 1), ('vulbibqjstijzjxqhihnqbdtxtxq', 1), ('pdtviihh', 1), ('rgkabnlzzdxe', 1), ('bbu', 1), ('mblyqig', 1), ('qgxsch', 1), ('uudhhxzddjbdghgpqvy', 1), ('zunurlurwtuavrtgigbh', 1), ('fd', 1), ('et', 2), ('jgxky', 1), ('fzpjvktfikztqfkrhjhkusui', 1), ('srvhwlfrwlhykqflhfiyzswdcp', 1), ('swfe', 1), ('bivjbb', 1), ('sgfqnek', 1), ('ntwhvztbqcqmezqdcicsttfnvvcynreclmwiyvaifjdofa', 1), ('dpqcihn', 1), ('ounpx', 1), ('vasgu', 1), ('nqmwbpybcvkj', 1), ('yhcyhoejiemflefb', 1), ('ocuqrmsyecpvzyivleghauunecml', 1), ('awexuetfvnd', 1), ('ynvx', 1), ('wdfxcv', 1), ('mwwhfldrjzks', 1), ('lftoudnip', 1), ('unkgigp', 1), ('iezncuqzohunuehfgggpy', 1), ('uknzhzaknq', 1), ('hoc', 2), ('ubrcm', 1), ('kxgsosbaootvomqmgqtznuhw', 1), ('sp', 1), ('mmcdlbxpvbhbptfhfhtvqpfyh', 1), ('rte', 1), ('jaumd', 1), ('jo', 1), ('atjvtx', 1), ('crjuxkvcfwo', 1), ('kzrttzxzheyerxrfafu', 1), ('n', 1), ('neisybdqgvjivtvjjfoxqzkgmzxwwpgibrhlwmemsonjgwf', 1), ('cgy', 1), ('ppk', 1), ('keqgfdiqjc', 1), ('yborxhqqukvlrieqwic', 1), ('jf', 1), ('oknaihpdrevakpkdhaycplfggoilmmiiu', 1), ('zuimtyeifyaxgkhol', 1), ('agsjnz', 1), ('bsfjmjrrfovbjrlmnupvbn', 1), ('ulhqffs', 1), ('cyv', 1), ('lqyylpowtrlby', 1), ('ubdnyrqy', 1), ('ltjhmbjezzcg', 1), ('kdhpikqctedngamerqpr', 1), ('wpaejw', 1), ('bflijmiykuchbtchx', 1), ('auun', 1), ('jfnzwyxcuqx', 1), ('sh', 1), ('ostqgzgi', 1), ('zotwktrvywpoqht', 1), ('obw', 1), ('lctxjmkiavyh', 1), ('utxgnloul', 1), ('uyj', 1), ('spwg', 1), ('ioqlkd', 1), ('oywfqlrgeq', 1), ('ch', 14), ('lwetri', 1), ('mtwnx', 1), ('kxlmeefuzgwspdrjv', 1), ('vgtrcvieoxmyzlcozajucr', 1), ('uqe', 1), ('al', 1), ('pr', 1), ('zm', 1), ('vjfk', 1), ('shamcbpw', 1), ('bzjgfnjonoembtcthkeczgtksfnzp', 1), ('cgwtlrahuoknrrqjhzdmssexzmvduqxujbpf', 1), ('kovonf', 1), ('dteeiaxbgvkkmbgi', 1), ('sbmul', 1), ('uls', 1), ('gmn', 1), ('cmrucfjblvbbhjqtqo', 1), ('nzymhmxieiifj', 1), ('gdtcjqywo', 1), ('pwectb', 1), ('syexhnvgnpo', 1), ('wklmtljevpnmwhukhsdfonpijesdbpfi', 1), ('rixqkrvzhbhmfkdpncxuclcqtmtshobkrx', 1), ('lnpeebk', 1), ('nbfgwoejsjtqugtb', 1), ('exrinrksg', 1), ('mb', 1), ('dvnscjgtrgv', 1), ('esbegizh', 1), ('qle', 1), ('mrhtpzahasyyeftrn', 1), ('mpofsxwfxklhqtu', 1), ('aprdgqttjvblfwasbefrzlscurrngwzzzweorhunnptje', 1), ('svyfrhotfgfdngo', 1), ('sj', 1), ('zxcdgpthggnchjthnijikfrofkcfegldrvrmuufmlxplmegsapxntuyaddvehbizoy', 1), ('agzzyul', 1), ('applicationpdf', 1), ('divalogoontwerp', 1), ('adobe', 3), ('illustrator', 3), ('cs', 3), ('jpeg', 1), ('jaaqskzjrgabageasabiaadqasughvdgzagwidmumaaqklnaaaaaaabaasaaaaaea', 1), ('aqbiaaaaaqabadkfkbjlagtaaaaaafbaiqabgqebauebgufbgkgbqyjcwggbggldaokcwok', 1), ('dbamdawmdawqdapeaodbmtfbqtexwbgxschxfhxfhxfhwehbwcndayebayghurfrofhxf', 1), ('hxfhxfhxfhxfhxfhxfhxfhxfhxfhxfhxfhxfhxfhxfhxfaaeqgayaeaawer', 1), ('aairaqmrafeaaiaaaahaqebaqeaaaaaaaaaaaqfawigaqahcakkcweaagidaqebaqeaaaaaaaaa', 1), ('aqacawqfbgcicqoleaacaqmdagqcbgcdbaiganmbagmrbaafirixqvegeeicyeumpghbxwxqipb', 1), ('uthhmxzicrygvelqzrtkqkyypcnuqnkoznhduzhtduiijomjchgzhjrfrqsvtnvkbrype', 1), ('otzxwflawxdxlwzhpamtsbwvyrdndexpfhfoehyahiimkiynjocksvlpeymz', 1), ('qbnjenkjpkwmpipqqusravoraaicaqidbquebqyecamdbqeaahedbcesmuefurnhigzxgzey', 1), ('obhwfmhrsncfvjicvezjdrdghasuywiylcbpsnejegxdukwgjchgzjjzfgidkdfuqozwygp', 1), ('pzhjsktmtuprldywvpbxfexrlzmdoawprbgubrdndexpfhfoehyahiimkiynjo', 1), ('dljwwlizmpucnzfkqokpaanqkmqqytrqvaaawdaqaceqmradaixwdkmpgapkxh', 1), ('nvdiruwuurpzdgxgvrhqbqslblbmigqmkhhvyctxiiamhabgmrdiexnzgcx', 1), ('wtxuiahcqlrihjqdupuhccxuskhjshjzrqqqjtgebajrfmtdsfxzewdvbnhbqvuhe', 1), ('psqyiduekhsvqgjelcrwaxwzpjwhjxxtlzltxvlfggwcjxsuxuvgtmhxuj', 1), ('jllahioenqevbbgqeeztufkfcaptzsapddrcydlvgqydctzgffxti', 1), ('bndmzmypehcmocervwnchypuswahbrxhedfzbzfirnjcfbixiajswwyvye', 1), ('lpojximolauqduehhpxgznixobxsjfcjpucxwsoadxfoewodxrhmevphivdptgi', 1), ('nswahqbgppyfaxyqlhrwlzpvalzutauntptjjmqanzdqkpnmnxyzoqiorms', 1), ('lqthpqopqauzmgotcgnwnmyvnmelfowbwptkbinfdlhzdbylgmabqjfssg', 1), ('cseuktagdgrgchmxmezehcrlytnqzoxvkuxvkuxvkuxvkuxvkuxvkuxvkuxvkux', 1), ('vkvinwdyamhjnhwamivqfmxvanyqwaqpjawfdbapebnozlyvphue', 1), ('efaoveiuktdymyfaxqymmbsyhaguakftmktiygpqhpcbjfcxhnemxzprlm', 1), ('dmskmdffopqqnpwzjyhoifnqfvffbfdlyxhuvjxhsflljvrkfadihwaodrh', 1), ('agfzeeudrafjnmjkihovpljpkzfclittgnvcsbupxlhxanwbqldkzbgyzv', 1), ('ribgsxfamnqigjynwbrbllqdaqxnzufmwcxdkvwbtlkvpevzyfpzdvdh', 1), ('lwneadbcqjkerfzmpxcgeeeiamvzzejyxhzuhshthdswiuhbjqugyj', 1), ('gcrcvhljdhihwxaybzlpqpwrdycjtvmeuftycoparslspumkbmzztqgu', 1), ('qtttlkxhmroefhpwmjoypakqngvzbnyctgbhegediefrearwglznesu', 1), ('nsitfjnfqndvkkffnmmxwitmkjxczuowfxyqfxyqfxyqfxyqfxyqfxyqf', 1), ('xyqfxyqfxyqkfzzmvhwcmfayyjzqbcxdvqfrlrkjywvlnalzvxazzusvze', 1), ('olrmfaoufajlahtpqfajuxmrsndxqvolzvaxqttvwdtmnkfmbvay', 1), ('rozthnlbjpewmnwatjyhykxwtrejianfdajqwpatoyioxsesfnssp', 1), ('vyxnvyirpyutmpqnvwaafvisyzxgyjuozznhxqljpamclyzrupnwrxutouaq', 1), ('nagqzqdsyfbrzvnfpvfiaoofpsnctatltelmfpwnxfzkurnmtfhwaappamqkf', 1), ('mbqsnhirbmmmekelzkxbpivpnxizhoendpytqswiyjauuwedxompbihed', 1), ('vamffpporsyyqfkepjzxgxtzygwqnvppiwtfjqddnhpvfrnssoemxofjkpby', 1), ('tymxugkujdyaqjnisreyscxprmlxmracdtyzvtjoudqfxyqfxyqfxyqfxy', 1), ('qfxyqfxyqfxyqfxyqfxyqkfzzapjryfmfacyjzqbcxdvqfrljvpzkltsviuh', 1), ('adfhbelldfcqmkdirogdlvyydgafullljiioxlnysrebhmhfndonkkztqeculcxu', 1), ('zryrdhsoqonpogcqrtoaphydnakwkslxdtmehqzpamnxllevzfkhwcurnohip', 1), ('sanspgzgyauempxbdhhylbaowabvlfaxhuvjxlsfllmdbzhwaofakhaxwbt', 1), ('hmrhlhawbyzzoppveyxrzrpfkoekrsjodwvyuipzgaognkfbpnlyjdrojgslmskmt', 1), ('ainwjkhdzodjxweuonyxzepacuplhojzpknwxkunjebcmplnqiajhqeuwhx', 1), ('lcozezfmzphlbynqsqghhmdnzesutuhymfyzqlhtiiuvknwxjffhlwatklh', 1), ('anapfxzknpivbrpiwkjvetlhglkadqywmjsyjajuzaafliydqpmpanpsl', 1), ('tmmyvlgvalrurptbnuwzynkklgjcscpydvpfmjfljkfxnhrnaxnfoflvqhmjyfpoqu', 1), ('omigvfhpchpsvfiyurwhkmxbypuqwwzjmyqfxyqfxyqfxyqfxyqfxyqfxyq', 1), ('fxyqfxyqfamxfcdvnpmfzpqmvwepwmntfsicuxmqfjvpixsoqobntdpqxxegojlxl', 1), ('kywbcoedprvpvzapvllxxxawameoflnojoulkxjwymrwgjcnhhsohhgdl', 1), ('extjbxbkojhuvfthftngyztldlwxtucqqikaafistusdydzmlnmynnmgfbbpdvra', 1), ('ujmytrvbcozjrcmqfjkuifftmqoegwtbtnwdbprscardkurmclurrwj', 1), ('mqfnuoeaoaxkdqhmkcbvbohfwcnowytcunaitvpoxmoaoahltxlnawljqoc', 1), ('cffahxxxmuiqgkhdieunmgbtfwpkvbvkyjswimklpfxjjliykcgdstfgbmlv', 1), ('zfygtdjhwxpivzplzznrtlmtrsgmauxcmqfcyupbxumaxahuwwyjkcswzyzm', 1), ('vawkptfdvtsdvlquyistmtudeifanuypwaxdmaakaymhbbjnadyry', 1), ('cvfpsmxulnvaxtkkkmhojxmqyaffcalohowclbamhjpgfkrxpmfyjyajpqttd', 1), ('vklxarbmqmotjxkqhrbqcdpdiuwzeeagpwzavbnmbudirsvdirsvdirsvdirsvdirsvdi', 1), ('rsvdirsvdirsvdirsvdirsvdirsvdirsvdirsvdirsvdirsvdirsvdirsvdirsvdirsvdirsvdir', 1), ('svdirsvdirsvdirsvdirwzrvmfapuflfnrenldzerybcielzcyarjuzosmomjkx', 1), ('xanxsyinfmnaohavopafonatwdvbmfvmfzfjslynhffaelvxnetaicf', 1), ('qtjkmpzpkvexjvzviluvdpwvdqfzzqyxjbgzcjodrixduqqtmzavb', 1), ('kxfckylkfxyqfxyqfxyqfxyqfxyqfxnxfxblnrsvkmyvomkbfwfbyeghfdozv', 1), ('zbzrvztoojedsgxubmktprmvtncgysmxynyddqnjdpadmaljglekgnzsvdir', 1), ('svebfldcnozptfrjvdhnqwfxhwpxkljtmfqfmqbujpxzeikvyekgnzyfy', 1), ('whniwnyxeqqsbnpdyxkzdsbjcrgxngivhldrbtmxyargcagbtupjcxgtezjnco', 1), ('xvkuxvkuxvkvmtafrzwdjnpatsvshwfvojzonodiqyeeggknnkwkcjs', 1), ('srkkqooqzmtsabhavzxinmdnkhrodrewtanprjkwuxbcwixhuabjxdfmfzaypexmliyq', 1), ('uoizpaoclvlwsaommaysexmvtjllkeaybzhrnhuksmjmlnexeqzqijoffmr', 1), ('chcfndbwmspyoluzsjkfwhhuxnftvcftzndreffvfgmnxhxlxmfuefbam', 1), ('plfnrpjyzjrpxjecyiirvyukoublxcuuzuhrmeoumsftmwjirogytcyiye', 1), ('sxzrfqwmzwraexjtjkwziqouoqywggpjbcpkntruscfzexfrjwccqrijkmnotrw', 1), ('epdztdefhxcrwakblowdskhlpfftyhvvziaeuerfplzrowckglyqjencoczqyurxd', 1), ('qsnxijbeuauaewkvsciexiweubmtbawujfiteasavzrurbyzmjaavykakgbwwpcpt', 1), ('ngotzxnandaekxdymavqliljmcqeahzbqjnxoxcpquoiifnvonndunfkbrtb', 1), ('ywxhtzwvjptuxzvfjgwckcgqbdrlnpliyxkdxrtexojqiflzjjkjtfmyfbm', 1), ('ltppwbnathyfzirralvdhvplxadaqgcdarnzfpbqtzxpdfpnunhssmamobza', 1), ('ouwrknljmxeezfwnobxxmgndczfkjydpmnaaeifltcpljzjleyelnqscep', 1), ('nporsobenldqsaehhhmfqtfpdudxtpngfjmpzhtetddgslsptyaasntaxvldryphi', 1), ('styentpyvtypflvozkcexvvmlopzfupkgvatfxalpqzxyroigkthaisflpmwbbphki', 1), ('bxvtgmtehdvsfmsnmbyxzajyyaatbkykunpyvfusqfacunfoezvdmydofcvilab', 1), ('cvvqwcznixshksnuizfgymrfvjqnapysymmimcqyxzydkdixeikgcpzgtrxvzdzkv', 1), ('crvxvqdolwxebgnobfaxbpsjgkrsfmltwjzayeysjxspcsaaasoxyzlbopjyezd', 1), ('gnnmiupmzoppuifinrfkgywtsqqfwpeioqfiushmhnhsaflhluphihdkyskhliiizveu', 1), ('tzvxpzmspjpmbtnfvnpaeluizlhgskpkymzlmwhexxmtaiygqpjqyzheghqxlvfcor', 1), ('tnhdtorwcboeqwaghcinypiarlehxhbmmhzrryeshuwaesjacadsctqtsz', 1), ('atsnxlrxtxesutbxikocffqhzlhtxknvdpeoloswojpbqbvahhtswdwaphx', 1), ('ohlcpvodfxpxbtmhbvhiftycxjxelefgwfzewcffzgwabhezfapnf', 1), ('kvanbixtpactzhkvotcchnzlvlebpwhhqtvqzfvvyccnacab', 1), ('xitldyjardxsxfqfrvxlcvzgopscqlxiwwzdpvsqhvtvkvjmmexpiwlzqwinrsivl', 1), ('vhmirujognwcgdounktdnmhgazycmqkhadknnvufixgwbfbswicxkgbherynjy', 1), ('wpucvsmxluzmjkehyamfxvqgskjrtzrxyjdtfmknwrzuwfvisgvclfwvvlgvxiga', 1), ('qdpdligcmdwbatjnbszyxxlfzngynlmicajyftdervatfkxnov', 1), ('vnnflwcaexhvojnizbiryrpwtmrrlqukmelnppbwsamhneokagbyihtnq', 1), ('ozpqwxaqchbahjinonnrwkymsbsshskeqhkztioacmjeobmkwdpyktxvfnxl', 1), ('thawishcsakrbxcifjiksppobvxnjznntzhbwdhobysmftfyxuioxknqdzdzs', 1), ('wndwpkzhshdqyxzkolmpiwamvqkiidylpiflpfcohvrdchnlckxjyvsmju', 1), ('haoyzykdipbgilybpadfesgxlaqlpmsqaaadreaqrgnjocispdtowlzimndl', 1), ('dvqbjfcmwdzjjkjtfmwanyvtppwzabazdwvjxllvtwstbxtojtotwziogpp', 1), ('sufvkvejmwgecymmtswwbnlfnzlbbwzcdcrfzhwpdxzpnaadstiyavlksvn', 1), ('glbftedcqlzlhalfintttxnczaqxmoerwyvfteabzxzzwauakzzvmawctzeqc', 1), ('xdsfseajzhzzxvarvgfuvairzenfibwfaffreuvoiljreqjublusb', 1), ('oqlhwkldnypmugmtzahtevqjsdajxumvpkwefvtwavuiomirjisrovvpdkad', 1), ('sdgytpozzdhoggmgbgptvfjukbwngtitbsxlnecricuyugbrxdvikouzvom', 1), ('ozqbyjplngdepvzjtrzqnbrbxehkfsruwziqasiuksopkpvkjfmsuxiowxfsdnkea', 1), ('laedsmvypwbgbyhtwhtvhmsuxdikeoatulleponrnevqltlussrzakusa', 1), ('donanvmkncnnjkygzsmaadyyvkztbtbzamidfgswxhxbulnwagabrwnwl', 1), ('eubzsvickjqlublwtuogqkoajwbafaztapdlfiyxlfzlywcojzonodirxtnky', 1), ('lfyppkiscopkjdcjahbzteydinfyhxeklxfqxkdycwmgrtotlnnmksofliz', 1), ('bmayshmxigbicxyckfwxkwdticgfeoxgadagijqysjoapmmqbqadjlapb', 1), ('ajuaajznczahwzkbhtgstleybjphadlgyyhkmirjjyixlosnrlznqxz', 1), ('ankfvamdzszroacvzfuyzfcivjscbvafsormbkfaaudmqrszzvuchpexhv', 1), ('ongzwccbvayyfndvfqjobztphojiafpefolfovzwdrsfmrhejmx', 1), ('krdiyjuztzllbplxftivsocrkyzoumxytwxnuyyudmfyeuobnsplcklckwy', 1), ('jijyqxupozcmxtakzsbipohusxniuggkbvopwojawwdxcxmcphaaethlezimhlfm', 1), ('ntbwfaoopajkjtfajndfnwpxcbazazxyveooswhltmysrjmyewrl', 1), ('rrlcnliaunecgdxkuraslzycpqmhxilkomkvpmhwrgbjwaaijmxdrmvkflo', 1), ('dzzjvkeievpciddxrgszrzysrdyrljvqdxgzjsyawupcngecoafuczswccxfa', 1), ('lmmgafnzmvuuhpvqkktmpmzvfwmdzlxivdtikfgepavidwcckbsw', 1), ('fqrbuwxbsyfplefbmfyazdtupgplqfefltotiyseclvkqstfmpvxofpyvtc', 1), ('nzpmsbuatfanggtfyzytsertmugtpncadxcdkilyxrboxtnnvoklplhegcuw', 1), ('jxgcoosgifhjijmtexwdyadiprwpfnoxyxrpakjmysnfurqpriisjlvnf', 1), ('nlrplphlzuxvhlwdbknsfkxmdpanjptebsldfmsxsjibknpzrgptjupi', 1), ('yzqkcnjivncvfunhveazyyqknnpyppmzyedfaawausycrrskeucisaffpludm', 1), ('ccxidgmiqovbdfxfyrxrrlrzgxkzwvpqycqgpapcssfivcuucnbueonhlnej', 1), ('mparddeonttifmlklybscjejdvnkfhljmlkclvhhtxbhjpmdwhikpjpjzi', 1), ('ingmxfsbpsrbptsgfiieoioiqepcpjzmpgrlzakfpizktxdegvdbsurzrdx', 1), ('ecjifucuslggrcefkbihfzsjagepljjluowkvlanorcwpptxnvqptvsngldo', 1), ('bmgshrrctlpnlzvegiyoxduxtpynkdlmtatjdxvyhqdaplitxqbjkkqemptj', 1), ('jbovwqtkbzkfmsjwyjesqppzrogfgcxtnouekityplfzzpuvysrwdfvprjkbb', 1), ('srvtvmqzqljiikgvonhgrkrpvrmoclvxltzlzfnkiygqnfjgywvkymnf', 1), ('ykhkbuztrmgdngiivzxoqiyehrfntytzavlgoabdsyrpisofthipdxubuonoablooyk', 1), ('ojfoikklusfnvvroiegyazpbsmqjgmuorzeuqcbqausvbuviytvvcopiy', 1), ('qslfoejnhykylroktpnawolsthjhkswezyeqsdfpwykxpjactohbptjvettootin', 1), ('geifrvjtbcxslsryowllhaazipknfczrojxlljibgzkyikqalbfzolvzongj', 1), ('wvisjvjzihunahdjoajkresdjhkvxjqnemxzlupxzxefkasuoqlxrcnwfnvcxiggyrj', 1), ('aaiesveibofhvrlktonzkuzshhyohkdipzjfwmljpdtzxmdqoorixgjlkrwm', 1), ('idxaglrdhgzgtuytgmygumipijfqzzmvmkmlwfnvunbmbmniavxivdmpskf', 1), ('nusubjirrnlrtizejphzxhiegqcmwncrmdwxunkxvffyryjgspzqqwbhgfpjnr', 1), ('phkjyckvwcgohgmyimuvakjcuxkpkfyjntpcgzmuhmaaakejlhysechioexbn', 1), ('nnzqomeqrxbneiezcejxngsnbejuiusrjozgxskvumhuhscoozhishmoqryovnft', 1), ('aovpnruoplifmogxllskjinzsgcwxhoponaphpvqzuznpqqdimndezwxaffh', 1), ('qndpfpbdravccwgwijupjxmsveqqinvxgdnpudxsaygtjtvborafvtohwft', 1), ('bactiwojsskjusxjumabnloszkerlwiiigjojypltfkeobplzdnolxzcwxscf', 1), ('czsbquxfnlocizgkamuamczripdcdkvdpanjyrlwdwhdmudrrfxfrhanpo', 1), ('hqfvhlidtlwnplmkzqhxcrafpctvysqnueahyyqfxyqfxyqfxyqfxyqfxyqfxyq', 1), ('fxyqfxyqfxyqfxyqfxyqfxyqfxyqfxyqfxyqxmfyhetfuidgnlzpczyqlkvhmej', 1), ('kqdazfhwqrcndnbhnbgnaftyxnliumxvjqfakbefufpasxdcz', 1), ('yxopaynvpqepnliumxvjqfrttxcvsxdppafggjbzqnjpfyu', 1), ('ufsfhkbefavphzsxdcwapadynvpaqnjpfyuufsfhkbefufp', 1), ('lfdznjfggaipufxlunbhnbwcrttxcwblfdznjfggwdi', 1), ('pufxlunbhnbgnvphzsxdczywbadynvpqepnliumxvjqfrt', 1), ('wbufplfdzadyxopiwcqepnliumxvjqfrttxcvsxdppad', 1), ('wajbzqnjpfyuufsfhajgnvphzaevsxdppadamjbzqnjpfyuuf', 1), ('sfhkbefufplfdznjahxopipufxlunbhnbgnaftxcvsxd', 1), ('panjfggjbzakpufxlunbhnbgnvphzsxdczyxopacnvpqepn', 1), ('liumxvjqfakbefufpasxdczyxopaynvpqepnliumxvjqfrtt', 1), ('xcvsxdppafggjbzqnjpfyuufsfhkbefavphzsxdcwapadyn', 1), ('vpaqnjpfyulcxkuxvkuxvkuxvkuxvkuxvkuxvkuxvkuxvkuxvkuxvkuxvkux', 1), ('vkuxvkuxvkuxvkuxvkuxvkuxvjkvznyeblgvrgcagsxmfvtbeksfbmakfa', 1), ('hbpirimvdirsvysdnmtlcgvidgbsppaosseaddhqmqjkoukojshtrerjvksunw', 1), ('ighfvjkbplnjdfzwtgehzxvocvdirsvdirsvyxearqladavyhovlgyqsbtrxvhl', 1), ('bekqkupxvoltbnspmvlknvrkgxbdtowpgcyevevljqyqnokuxvkuxvkuxvkux', 1), ('vjoeccyttmetqsfxdllhxogkgsibfaaqinzfzcnwhdgjstptsvnzlsyu', 1), ('sqcmlzuiusxvldwxvomvdirsvdirsveheeppujvzvvnzuljyxoemtxfadrwvrybx', 1), ('hyeiokfaihvmycwqsecvmlspmemtyxbqtptczncywpmwwwdmzaruvffiquf', 1), ('lttweweztwzxdoqtnfslckthsqxpjubnjsilkuqqaqmpktxntuyovvbu', 1), ('dnjbuoxvkmekkteloemiqsshwontxvekftfjuwmavlyssbsogulmrvvkdxx', 1), ('nigppoxslwaqekpdwvwoltzwctehhuvnaczvxiscksquvwnnwhnegobxvbv', 1), ('seapnutrzoxowgafcnpmkxbxjktaytxlhrdngdpxqqyxqfmlappaofhdac', 1), ('tomhdzbdrzolkirkpasfoqrgnnwxvopplapsinnqvrnqkdzekelmoblm', 1), ('weomxqygonszdwxvjdaddjyqvujpjyyuztnwcylezcggedmsfjjsmybrtt', 1), ('qxjznmuxvkiytdadkvnbusfxlclrdsqjpdupsrkjsqbcqhosvncie', 1), ('ugkamluitzzilkdnigaidckhftirviqauevvjpqsbpspmgqhdgahpttsu', 1), ('pltjiehtoowympauwwcvezkgakmghufekttetlzjqmdvdpiuzbyzplxtccv', 1), ('rajebcroppxehhqkvqholfatunnpzvqvqfpfxsutlzwckegwkrqyqybrley', 1), ('irruvzvndubygmundujgbkgbwayxblcryijesmksjoswmetyihnwuvdtis', 1), ('yslqlvypljwtnksfchudskbsvzjjoteepztufjvqpplvyaqwsntptbcfdfhbczv', 1), ('jyxhvbxcqaharronfnhrejdxdrhyowmxvbwcpmyrovyvkbxktwdiqgpexnw', 1), ('mdzfmwdmorwflydvnwxulzxexqrmxkpqekovabmbpiqmlnzjfxacluuvrjw', 1), ('dpakgqahaazdxbiwkvsktyhxxsagpjaaxvkvyrrmlbuppuebygtprxdbalwl', 1), ('athexhbrbrjxjrhrtqplyqryzqvexgjqyjyfiyripbtqisvkuyziabwz', 1), ('vtjvdikxgtxnshqystcqtujexsbwvrozuuictipiqqabstpmxarhsryta', 1), ('tboipdfxerwajuwiryfyqbtlhcvzjzalfalfeqqleslpplqipnxihtcvrlivr', 1), ('ccsdnadqvpralyxzdqnxdnxbewtpyeihtyhmaztwpzkzpxwigbvbflljxjd', 1), ('zbvfvztvzhvbglckeqrcchgkkigmunfhfwaazqgowfyhionlmozicsstjkbldk', 1), ('fzjjpqpxfyjrfnlwfjvltreqbxzbiwgkmyytapcjmcyfixiwtiknvyvssfzja', 1), ('varupjfnqxletbabronvjdpcsskxjfuzxalrswxvlmybzsflstzno', 1), ('mkaktlqyedozuieckmqtftsqbhkcrlnouvoknvcvzbjdcnsktzklcjzxsaqb', 1), ('yxixngugcoxylejyptllpnvatnlptjzbzqvxzveyxcqoxrpxrypqxwflltfa', 1), ('ngaabptuimmlgputxdamaactexplwemaqvskpjnhvswoxyexzdwbrnntikm', 1), ('gdsqkttivfhurgbfxoohaxfpoiafpuvbfywnrgbwximuhccvivluxnjygmraafjums', 1), ('juiwmtwkdynvudmecbktripsvznrmkebdakjvdnlsbswzanpellayvgekqfoak', 1), ('iuvzdqgegbuosofnkhealbdnvxltsvtzaeejymlzyfwrbgfqxpxehbcqflvrr', 1), ('ajsewnhefljwvkmmdjijsmskplezhrzlsdzsukpnomtzrrgsfspiphktqqua', 1), ('lxzbpdzaruxcgdbtwovvflmtvqacwpxqdkrrayusyeneezokckwxnmcuuvluux', 1), ('wutxxqnhwwkzuivpkuzqskfryuemvzzdwgtjoajmsbihhveqiqkgkvclmvalju', 1), ('zpiunetjdrnhfdqwmspcqlzssjvijqiyhphxbcakpnqxfalfnhftvjglzgsxuvrdfx', 1), ('howevccuyxlbwztqsvthyflosqbpkguwegnlhqipzdjiemsrsuqrdcjfkvsqpxjr', 1), ('txvbadpxntzlbgyttstohlvqroexwzdpmubkgfjkslmvyrqqukvruxvwlsfzanmr', 1), ('rvrljybpwzlhkhulvjrsixenkjjlipidmvupyjfwfpnmuoklnudvltsgblgw', 1), ('lhhhepyqgqopphirjydtzylwtdvgbpobmccqfmujxkcukeiwkxnqwasvms', 1), ('aahxvytfngrrdxvhiylfrmtyzkvnusvxkilwufunqnsedvlshklvkrewlsjhtemeh', 1), ('dehqgspaxxiqktbbfwkswvnnlmstpnyktvyvipusrimxutjaqwtcfzoahrvngvi', 1), ('fjplrwttmmfztfewqwnvpysqwwbpzazagjubqokqdfurxmlebddebtuvjza', 1), ('qctahneytbhaselrvvknvsrxtsqqihevnctvfzaxvdtpufmoppdzowvnaytofrtpvg', 1), ('jpuosadxgvzypzogfljeewppktwxwiwnibcqurezuuefebpstvpupuavzcpybu', 1), ('pczlxyppkhnuutmtrioekjylezlsikkafywxcqdvszdfmmrevrlyvpolvdpbqaxdt', 1), ('nuemsormtuoymygpusfrsmkssnpyrrrxllzhddwkqxeqalixgauylifywahomio', 1), ('ipaziqyevtcaxrwfjadomutnjdsptpaioyedffnyxhxbpqhwdyqfxyqfxyqfxy', 1), ('qfxyqfxyqfxyqfxyqfxyqfxmoerzblnvrorfoliyywmbxvfkamkgvgrnhsrcq', 1), ('rpqyqzdyftnyndsbpwwzsiduaysoxlpiqzsstgkpzirsvdirsvdirsvdirfzmnx', 1), ('pnlybfewlhfxhetzwmheccqysoumnufoukslghighjgiulfeosnrcqkafdiqfxyqfxyq', 1), ('fxyqfxyqfxyqoahewnhcspdaxpnkfmnszfgmvyalnmxzrhrzbqlvfamoxtmbed', 1), ('lwvpuyrknkaypfwtqfxnhheapzwuxvrgmgiywngnyklnciziggkivdkxqfff', 1), ('cufwvjnmhajfuqvqxqrjhuzuezbsmuokrsohpiqnaqebzztebfmeludnibt', 1), ('dauynnujbiorwidubqztxeodskplrmtzhnwkmecdgirwzbgslmmmpdqqelcwdk', 1), ('ynsfwqftwfomhldypeafiqchtmvxfkeeeiajzvttuqslxzdjvjatjljsgbu', 1), ('iawkkvbzigidvqsabkokoxtpotfaoaztigionanywxciguxvyqyrnfiflulcvdzx', 1), ('narwmijtinunbaqjmcryjoqpucfcvzhirsvdirsvdirsvdirsvdirsvdirsvdir', 1), ('ypznpwwnhyutcytsrhstfacwpxmfwmmaoocmokofsrsctwqvaiuuxpzzbytca', 1), ('faoaomrwoqyietfxetrmaivgxahacgqllqxmrbdeaajdvsmxlztjigy', 1), ('wmnzlyounnpkmbdcvatvziwjzjxrpmhurnrditpsepwjklewgdqaolvdtxxfwv', 1), ('ectzxypsvffidzstijhadqyxzygevittjxfywdmpqfnhsvynahpupzrbdcut', 1), ('nrlesgvocrnrxrxscksmslzgfzdfrffvajlvdoujnrlmwohjjchyuxcufa', 1), ('kmxcrpzcxumovqwlurywmsluzneotuqbqyeqlpnzjcflzxxlqdkntlvvpotje', 1), ('xbisftwjcyupkitjeqairxcrerrzbbuyzedzmvncfvdvttnrrviiuqqzeccp', 1), ('tddbtugvmqgmcvmfciryyflwjzlvzffwekppgcneqreyhxoevtphhcnutigi', 1), ('lhgtbwgkvnvanhejrjypeypekyzxvvblqkkxjapircvwzltvyotyfyplnlzh', 1), ('ajbimbdvgixvzgryhtmvlxycvpljwgqqcscvrhbylbcraopbwanybdq', 1), ('fcjvvuihoeqwrynkmfpnnrzhclnzhztqwqxosgeldggszwzvhatenbtiqpkv', 1), ('zjsotybphmxyplilhdyrehvaguggqmfvccjhtxrxfxuebxyqfxyqfxyqfxyqfx', 1), ('yqfxyqfxzakfbtfzwzleqaomixzretzldppqkjoyestwblyyvzjbsezdt', 1), ('dzvxxwhjumsawmcblsygjkrovbkyhtyqxfyvkmnyzgtvionrsfztzrs', 1), ('kgpuasottwurdlippzfnvmoyqybpyvnspymyrovunvvnjmtrusphunmwifvgrqqot', 1), ('btxvafndfmpylonhlftdduuswbooqwlaywxybaimxjfotoqolkbqzlzbomrva', 1), ('mllwkoiahdfxzdcfrujyxddgwnujkmcvqsvecfnlpoujfuxpqwjrdletyvezy', 1), ('cbznwnwidhlxrfcqqxfmfpuraypjnnkvxwpwjtztanynjinfeiytatijyxcahoxfi', 1), ('qmnxnrnmcfrttpncqbglfvdvsaxuuueygiqwaohqinwrzfxnpjajrgtmbatobow', 1), ('xrtovzukckwxswqnqgbpyzgyqylygyeqdfxressaxmhsyflsgszdgpuduvllgkvp', 1), ('fjpnjzjclaretvyazitywihhgeckobgrpcurpcturhvdzjswpnpmxtvvzg', 1), ('sxrfyfozqkyramuphzjzuhicqilnoovltthtoluntrzffuzreuiybllhqybe', 1), ('ydmmmnqslryrpknwpzesraxvjdlrolqixloiqzsortvphdhvqypkflvdllrt', 1), ('pgjdtzzbmsxetxkpdaayalaqdujqwcdfmrzffwukfjbafzaxpfitfnjfafzmm', 1), ('cyrqqfxvkuxvkuxvkuxvkuxvkuxvkuxvipxetlylzksnruirruuubuiawjew', 1), ('klvxkaaoxvlkuxvkuxvkuxvkuxvkuxvkuxvkuxvkuxvkuxvkuxvkuxvkuxv', 1), ('kuxvkuxvkuxvkuxvksvjdzpumaxywmhrnpmmcvzqzhpxulukqyrfxyqfx', 1), ('yqhdvchtdlvnrnhsojliumsfayqwoxtahwaxwgeoswkwohqysxdriuhajbhx', 1), ('xpsfxvjczdehlulkvbdqagntcapfvkqdzcrwvlctnxhhrpjgfqvjyqxtvnwma', 1), ('fjuliacoeqywofekjkanypojydvznirffppnwbyeewksxfxfmdvitocnjyjhyfpz', 1), ('jcvtabhfuyzxohxwktzifwrtlcwsncazwtvpsqanziqcyqfxyqfxyqfxyqfxy', 1), ('qfxyqfxyqfxyqfxmpmlxnmjzdesfkeojrllriizmetrgkehkggsqcfljrflgkp', 1), ('czdvtnaupmfmlprbrfwbcsafirqnyzlleoimnvhrumbxlhbtzjfrzfmiebpnb', 1), ('srdaxawvvbwsjmauyukgzmtiklvadtxcrmrnnxsvyxpzrlbdjnylowgcixvzkli', 1), ('onfdiruefrxvknapzpogjajtzhjpftrrwjgoedxtinzblcbihjjhxbvehefc', 1), ('qnqbbjyvpmnqvjendfbsiwgnjokhqogcfngvjpjvambqimlxxurvyefbdtlgck', 1), ('edluxuohropmdfdxwjkpnferppvteygiqzfbcfbykiwmodtgcsuvanbpggavpkkog', 1), ('mwsntfpmqiqpogksfqnruoyfipodsslnlxjtkmcxeegmzckitopwgkpbdn', 1), ('vvfioutenfnagatyldyrcfvohjsobkcupvsmksbmntvzyulbqhmxvvomlxfmcw', 1), ('apoefbvyiakblcurxeschrzirknauncqexfyynjcfuvlgzvncqzgtoodkmgfw', 1), ('xvppzwxpzrnrlotrmttpiqozfukdpcdhhfszzkvfvkwmciyextlvdyljh', 1), ('tlckwicvkrufvspzowsyvzlsbxxmywwfwihffaskwwzbirbziuxvofohmrx', 1), ('rzhzlomurobsysxeyxczgjejhdajjevnngajptfvkhzbrjzgoerqezauu', 1), ('sdqbcitraxatijwhavipihqbirlarsvdirsvdirsvdirsvdirsvdirsvdirsveowuxpem', 1), ('jvlrrdrutmxzwxulpptjdoxsltanhdfzvmkplyynajlxblyqfhqwowvz', 1), ('ksrmsakkeadooutlwjyzkrvdxvkqlmgwvplwcrlolwscwatfpvvbwynlkqilqxvud', 1), ('makxynaqrfmtkurhyzfslrmtvkvxafpbroxothbmjleqrkvohvqvrhlebudcxl', 1), ('toxzrfapyluncuditgkdnbljvfmkfbuvxksabzvmfntmxadrjrlmvlzfpmu', 1), ('pktfrlmcjiykoojddtveevfmdthldqtrkhmsababkcvpsahfdarcvzttrl', 1), ('nypbywoabyazxusqwmrnnrqcyarruwevphcsyslufjdeckkopensyvhciyzfuhhj', 1), ('geipqoezwobpgvfjrsfymsiwauvppyjimhsgujbforepcsxmysepmllcmpagfwua', 1), ('wctnbsfcelonwgmyvptfqwovenkzwjprfzgifeweqkjokqfgbtsmrvlflqlqx', 1), ('featapreolpjbgsuthiaygtkfmbiiarviqfajrsjfmnkzxdnogkpfwlwmttyw', 1), ('eewvolkkdrepgqqasdwbzxdegagdchtpllywvlqyutqttxmuenuwsklkxedlsmk', 1), ('pjpcpvypttuaeslxqdshtktbffexuflmwqxnvhlvwrgfunnpaypsbvl', 1), ('gysdbkgasesllwssydhfdyqknmpttedvmmsecfkjofmgcxfstqttxqswlpcij', 1), ('ywuriyzianopovzwcwgxmnqumesfoqzmckktlezubqogtheqyivmfzbrsfkfzxirsvd', 1), ('irsvdirsvdirsvdirsvdirsvdirsvfz', 1), ('xmpdideafffbb', 1), ('uuidcbbbbefdcbcd', 1), ('uuidfeebcdfecedcfedf', 2), ('proofpdf', 2), ('uuidcefaaed', 1), ('xmpdided', 1), ('xmpiided', 1), ('xmpiideafffbb', 1), ('print', 2), ('document', 15), ('false', 3), ('millimeters', 1), ('black', 4), ('pantone', 2), ('blue', 3), ('c', 55), ('standaardstaalgroep', 1), ('wit', 1), ('cmyk', 59), ('process', 57), ('zwart', 1), ('cmykrood', 1), ('cmykgeel', 1), ('cmykgroen', 1), ('cmykcyaan', 1), ('blauw', 1), ('cmykmagenta', 1), ('spot', 8), ('grijswaarden', 1), ('heldere', 1), ('kleuren', 1), ('xref', 1), ('trailer', 1), ('startxref', 1), ('eof', 1), ('hrdag', 1), ('clustering', 4), ('solving', 4), ('deduplication', 2), ('write', 6), ('tens', 1), ('pairs', 2), ('records', 3), ('assigns', 1), ('pair', 2), ('probability', 1), ('refers', 1), ('person', 6), ('pairwise', 1), ('pretty', 2), ('good', 12), ('another', 3), ('ill', 6), ('explain', 2), ('assess', 1), ('quality', 6), ('postprocess', 1), ('resulting', 1), ('reflects', 1), ('so', 4), ('mind', 4), ('nontrivial', 1), ('mixed', 1), ('true', 2), ('jqueryui', 2), ('checkboxradio', 4), ('icons', 2), ('enhances', 1), ('standard', 8), ('checkbox', 1), ('radio', 3), ('element', 5), ('themeable', 1), ('buttons', 5), ('appropriate', 1), ('hover', 4), ('styles', 7), ('widget', 2), ('foundation', 4), ('hosting', 4), ('ocean', 2), ('cdn', 13), ('stackpath', 2), ('stephengrider', 1), ('jsplaygrounds', 1), ('ifocop', 1), ('formations', 6), ('metiers', 1), ('formation', 17), ('developpeur', 4), ('full', 21), ('js', 18), ('dveloppeur', 13), ('sur', 1), ('dossier', 2), ('entretien', 1), ('personnel', 2), ('approfondi', 1), ('recours', 1), ('validation', 1), ('acquis', 2), ('professionnels', 3), ('nos', 1), ('oprationnelles', 1), ('proposent', 1), ('pdagogie', 1), ('anime', 1), ('immersion', 1), ('entreprise', 4), ('consolider', 1), ('carlsednaoui', 1), ('ouicards', 4), ('carlsednaouiouicards', 1), ('flashcards', 3), ('study', 4), ('everything', 7), ('bucket', 1), ('leitner', 1), ('relies', 3), ('localstorage', 1), ('fancy', 2), ('schmancy', 1), ('completed', 1), ('attending', 1), ('hacker', 4), ('school', 9), ('mit', 12), ('pubsub', 4), ('brings', 2), ('scalability', 1), ('flexibility', 2), ('reliability', 1), ('enterprise', 1), ('messageoriented', 1), ('middleware', 2), ('send', 9), ('september', 7), ('tryolabs', 3), ('gaining', 1), ('interest', 3), ('big', 5), ('complex', 2), ('applicationsone', 1), ('tricks', 1), ('freebies', 1), ('monthly', 1), ('hire', 1), ('channel', 3), ('progressive', 6), ('vs', 26), ('wrong', 4), ('fbaddcbb', 1), ('toask', 1), ('though', 3), ('pwas', 1), ('bunch', 1), ('misconceptions', 1), ('strikethey', 1), ('smooth', 2), ('fullscreen', 1), ('spas', 1), ('isnt', 2), ('worth', 7), ('etcstrike', 1), ('opinions', 1), ('musings', 1), ('members', 2), ('awwwards', 1), ('networks', 6), ('stereotipical', 1), ('socially', 1), ('awkward', 1), ('geek', 1), ('among', 1), ('usually', 1), ('prefer', 2), ('sites', 10), ('communitydriven', 2), ('focus', 4), ('awards', 1), ('creativity', 1), ('innovation', 5), ('trends', 2), ('private', 6), ('stackscale', 1), ('semrush', 2), ('hidden', 3), ('game', 7), ('changing', 2), ('adwords', 7), ('auction', 6), ('insights', 8), ('gamechanging', 2), ('sometimes', 4), ('doeverything', 1), ('campaign', 2), ('keywords', 1), ('adjustments', 1), ('based', 6), ('experiencemysterious', 1), ('shifts', 1), ('performance', 8), ('thursday', 2), ('domain', 23), ('successfully', 1), ('giphy', 4), ('giphycapture', 1), ('capture', 2), ('gif', 3), ('couple', 1), ('clicks', 1), ('captions', 1), ('adjust', 2), ('export', 1), ('size', 3), ('upload', 1), ('ar', 7), ('gifs', 1), ('stickers', 1), ('asimovinstitute', 1), ('zoo', 3), ('networkarchitectures', 1), ('popping', 1), ('hard', 6), ('track', 6), ('knowing', 1), ('abbreviations', 1), ('thrown', 1), ('dcign', 1), ('bilstm', 1), ('dcgan', 1), ('anyone', 2), ('overwhelming', 1), ('navigation', 24), ('asimov', 1), ('institute', 1), ('proudly', 1), ('theme', 14), ('yuuta', 1), ('felix', 1), ('dorner', 1), ('introductiontocss', 1), ('simpleselectors', 1), ('well', 11), ('socalled', 1), ('directly', 7), ('elements', 4), ('type', 7), ('class', 2), ('facebookincubator', 1), ('facebookincubatorcreatereactapp', 1), ('macos', 2), ('issue', 3), ('alternatives', 1), ('converting', 3), ('custom', 10), ('bundlers', 1), ('browserify', 1), ('includes', 3), ('walkthrough', 1), ('topic', 1), ('askubuntu', 1), ('clean', 3), ('install', 8), ('connect', 17), ('wifi', 3), ('networkmanager', 5), ('nmtu', 1), ('nmtui', 2), ('performed', 1), ('asus', 2), ('nvz', 1), ('sadly', 1), ('able', 2), ('gui', 2), ('entered', 1), ('nothing', 5), ('networking', 1), ('vyhphku', 1), ('hans', 4), ('zimmer', 5), ('interstellar', 4), ('httpgooglyrnhhans', 1), ('themepiano', 2), ('patrik', 6), ('pietschmannhi', 3), ('name', 23), ('pietschmann', 3), ('player', 3), ('arranger', 3), ('hobby', 4), ('germany', 3), ('huge', 5), ('arrangement', 3), ('inte', 1), ('primers', 2), ('rich', 1), ('experiences', 2), ('periodic', 1), ('background', 1), ('syncs', 1), ('push', 3), ('notificationsfunctionality', 1), ('normally', 1), ('require', 2), ('applicationare', 1), ('provide', 5), ('technical', 1), ('rely', 1), ('prepare', 1), ('pivotal', 1), ('arrived', 1), ('natively', 1), ('promise', 1), ('revolutionvibratoire', 1), ('larnaque', 2), ('flammes', 2), ('jumelles', 2), ('quand', 2), ('age', 2), ('deforme', 1), ('lamour', 3), ('profit', 2), ('matrice', 3), ('dforme', 1), ('rfrence', 8), ('thories', 1), ('observations', 1), ('expriences', 1), ('relatives', 1), ('corruption', 1), ('dexistence', 1), ('je', 3), ('renvoie', 1), ('diffrentes', 2), ('tudes', 1), ('menes', 1), ('sujet', 5), ('crits', 1), ('cameron', 2), ('day', 9), ('savrent', 1), ('plutt', 1), ('complets', 1), ('pertinents', 1), ('oops', 2), ('mdias', 2), ('guerre', 1), ('linfo', 2), ('acmethemes', 1), ('vyzgbxinpuk', 1), ('thrones', 5), ('httpsgooglhjdrramin', 1), ('djawadi', 2), ('ramin', 1), ('baqend', 2), ('sub', 1), ('loads', 3), ('lessons', 3), ('learned', 7), ('bbbeed', 1), ('subsecond', 2), ('lessonslearned', 1), ('tvshows', 1), ('shark', 1), ('tank', 1), ('dragons', 1), ('den', 1), ('uk', 5), ('die', 1), ('hhle', 1), ('der', 1), ('lwen', 1), ('dhdl', 1), ('ger', 1), ('young', 2), ('startups', 3), ('onetime', 1), ('opportunity', 3), ('pitch', 1), ('products', 6), ('magnates', 1), ('front', 11), ('audience', 1), ('faster', 5), ('consocollaborative', 1), ('categorymobilite', 1), ('consocollab', 1), ('bikerr', 1), ('location', 51), ('vlos', 1), ('entre', 11), ('particuliers', 1), ('ricostacruz', 1), ('til', 1), ('load', 5), ('rubygems', 1), ('placing', 1), ('javascripts', 1), ('vendorassetsjavascripts', 1), ('actually', 4), ('pipeline', 1), ('rstacruz', 1), ('onradar', 1), ('radar', 1), ('tauday', 1), ('tau', 4), ('manifesto', 3), ('surface', 2), ('area', 3), ('volume', 1), ('hypersphere', 2), ('investigations', 1), ('generalization', 1), ('arbitrary', 2), ('dimensions', 1), ('sphere', 1), ('defined', 4), ('follows', 1), ('convenience', 1), ('assume', 3), ('spheres', 1), ('centered', 1), ('origin', 1), ('tee', 1), ('openclassrooms', 2), ('courses', 4), ('creez', 1), ('propre', 3), ('fps', 3), ('webgl', 3), ('crez', 2), ('merveilleux', 1), ('vousavez', 1), ('toujours', 3), ('voulu', 1), ('possible', 7), ('professeur', 1), ('bonjour', 1), ('venez', 1), ('nouveaux', 1), ('usages', 1), ('d', 16), ('offre', 10), ('jobset', 3), ('recevez', 4), ('offres', 9), ('demploi', 2), ('jobsetio', 2), ('utilise', 4), ('amliorer', 1), ('lexprience', 1), ('ces', 8), ('ni', 2), ('communiques', 1), ('utilises', 1), ('identifier', 1), ('contacter', 3), ('cliquant', 2), ('bouton', 1), ('ok', 1), ('consentez', 1), ('sauvegarde', 1), ('blocs', 1), ('ordinateur', 3), ('fonctionne', 1), ('confidentiels', 1), ('jusqu', 2), ('faites', 5), ('remarquer', 1), ('soyez', 2), ('prts', 1), ('prochain', 1), ('belles', 1), ('entreprises', 3), ('dtail', 2), ('salaire', 1), ('quipe', 1), ('interne', 6), ('excella', 1), ('typescript', 7), ('context', 2), ('exist', 3), ('concrete', 2), ('key', 10), ('terms', 8), ('trackbacks', 1), ('vizeat', 3), ('immersive', 2), ('food', 3), ('events', 9), ('cooking', 1), ('tours', 1), ('dinners', 1), ('brunch', 1), ('surprise', 1), ('loved', 1), ('discover', 4), ('authentic', 1), ('dining', 1), ('party', 1), ('conditions', 6), ('sarahsharp', 1), ('foss', 2), ('heartbeat', 2), ('analyses', 2), ('health', 1), ('contributors', 4), ('ways', 8), ('likely', 2), ('continue', 6), ('participating', 1), ('roles', 3), ('greater', 1), ('responsibility', 1), ('fossheartbeat', 1), ('usage', 1), ('modifying', 2), ('training', 9), ('additionally', 2), ('vimdiff', 1), ('highlight', 1), ('individual', 2), ('words', 2), ('labels', 2), ('changed', 3), ('highlighting', 5), ('whole', 3), ('vim', 2), ('highlights', 2), ('diff', 1), ('codepen', 10), ('frontend', 4), ('deploy', 1), ('show', 14), ('cases', 4), ('inspiration', 5), ('enable', 3), ('devfreebooks', 1), ('advertising', 3), ('paid', 1), ('bookswanna', 1), ('herepowered', 1), ('harpjs', 1), ('pages', 14), ('bootflat', 1), ('mitmaintained', 1), ('caio', 1), ('ribeiro', 1), ('pereirasee', 1), ('devfreecasts', 1), ('devnewsletters', 1), ('watchcoins', 1), ('leblournaldechristineberrou', 1), ('dix', 3), ('pistes', 3), ('dresser', 3), ('creativite', 1), ('eme', 1), ('etonner', 1), ('crativit', 2), ('tonner', 2), ('cher', 1), ('blournal', 1), ('mis', 3), ('temps', 3), ('tcrire', 1), ('parce', 1), ('jtais', 1), ('morte', 1), ('trouille', 1), ('chaque', 6), ('fois', 3), ('javais', 1), ('ide', 1), ('demandais', 1), ('estce', 1), ('vraiment', 1), ('indispensable', 1), ('monde', 2), ('sabonner', 2), ('courriel', 1), ('rflexions', 2), ('laisser', 2), ('commentaire', 2), ('annuler', 1), ('rponse', 1), ('conscience', 2), ('eveil', 1), ('spirituel', 1), ('amour', 2), ('vrai', 3), ('signes', 2), ('trompent', 2), ('mystre', 1), ('peur', 2), ('laventure', 3), ('dsir', 2), ('dexister', 1), ('pleinement', 1), ('cinq', 1), ('critres', 3), ('aider', 2), ('mieux', 1), ('cerner', 1), ('quest', 1), ('prouver', 1), ('projector', 2), ('tensorflow', 1), ('embedding', 1), ('visualization', 2), ('highdimensional', 1), ('youd', 4), ('tensors', 1), ('metadata', 1), ('sprite', 1), ('bookmarks', 1), ('tsv', 1), ('publicly', 1), ('controls', 1), ('pca', 2), ('approximate', 1), ('lectures', 1), ('quantecon', 1), ('py', 1), ('needforspeed', 1), ('does', 3), ('mean', 3), ('switch', 4), ('fortran', 1), ('appendix', 1), ('options', 4), ('thomas', 2), ('j', 3), ('sargent', 1), ('john', 3), ('stachurski', 1), ('created', 9), ('sphinx', 2), ('hosted', 3), ('aws', 1), ('rejoindre', 1), ('actu', 2), ('recrutement', 2), ('femmes', 9), ('deserte', 1), ('informatique', 5), ('php', 6), ('dsert', 2), ('linformatique', 4), ('ada', 1), ('lovelace', 1), ('grace', 1), ('hopper', 1), ('frances', 1), ('allen', 1), ('adele', 3), ('goldberg', 1), ('noms', 1), ('disent', 1), ('rien', 2), ('sans', 7), ('elles', 1), ('pourriez', 1), ('peuttre', 3), ('lire', 1), ('aujourdhui', 1), ('vendredi', 2), ('stage', 6), ('partag', 2), ('engag', 2), ('ici', 5), ('alertsy', 1), ('alertsysmartnews', 1), ('zenkit', 4), ('beautiful', 5), ('trello', 2), ('hughes', 1), ('wwwthenextwebcom', 1), ('tasks', 2), ('preferences', 1), ('secrets', 1), ('zen', 2), ('power', 6), ('stressful', 1), ('choose', 1), ('five', 5), ('capable', 1), ('complicated', 1), ('beginning', 1), ('slows', 1), ('intermediate', 1), ('become', 6), ('comfortable', 1), ('dom', 6), ('say', 3), ('funny', 1), ('um', 1), ('eh', 1), ('geocoding', 10), ('addresses', 2), ('amphitheatre', 2), ('parkway', 2), ('mountain', 2), ('geographic', 3), ('coordinates', 5), ('latitude', 3), ('longitude', 3), ('markers', 3), ('position', 5), ('map', 10), ('retrieving', 1), ('vhnjbtythhu', 1), ('vuforia', 11), ('unity', 7), ('developing', 2), ('publishing', 1), ('tablet', 1), ('phonel', 1), ('missed', 2), ('camera', 7), ('target', 1), ('cyber', 1), ('soldier', 1), ('covered', 3), ('httpwwwvergiumcomimageandarcalso', 1), ('webpacker', 4), ('railswebpacker', 1), ('preprocessor', 1), ('bundler', 1), ('applicationlike', 1), ('watched', 1), ('released', 11), ('vzemyljgapsu', 1), ('hallelujah', 2), ('leonard', 2), ('cohen', 3), ('wouter', 2), ('van', 2), ('wijhe', 2), ('original', 2), ('httpswwwyoutubecomwatchvkqca', 1), ('httpwwwpatreon', 1), ('ibm', 1), ('developerworks', 1), ('wa', 2), ('neward', 1), ('seriesthe', 1), ('busy', 2), ('over', 4), ('three', 4), ('biggest', 1), ('changes', 1), ('specification', 6), ('objects', 7), ('types', 6), ('proxy', 2), ('permanence', 2), ('espace', 1), ('travail', 4), ('vieux', 2), ('moins', 4), ('rveurs', 1), ('bosseurs', 1), ('fainants', 1), ('fous', 1), ('lecture', 3), ('fixe', 1), ('rapide', 1), ('ville', 3), ('fibre', 1), ('optique', 1), ('haut', 1), ('niveau', 1), ('totalement', 1), ('gratuite', 1), ('bien', 7), ('sr', 1), ('petits', 2), ('gnrales', 1), ('vente', 1), ('sketchar', 2), ('drawing', 2), ('easilyusing', 1), ('begin', 1), ('typing', 1), ('surrounded', 1), ('quotation', 1), ('marks', 1), ('ending', 1), ('semicolon', 1), ('gregg', 1), ('hit', 2), ('enter', 3), ('basics', 1), ('skip', 1), ('ahead', 2), ('road', 1), ('trip', 1), ('javascriptcom', 1), ('kindo', 1), ('communiquez', 1), ('autrement', 1), ('ce', 5), ('poursuivant', 15), ('acceptez', 15), ('lutilisation', 14), ('afin', 3), ('damliorer', 1), ('fonctionnalits', 1), ('performances', 2), ('savoir', 15), ('rendezvous', 3), ('cette', 6), ('eschults', 2), ('usefulstuff', 3), ('eschultsusefulstuff', 1), ('memo', 1), ('beloved', 1), ('students', 2), ('keyboards', 2), ('mac', 1), ('characters', 3), ('navigate', 1), ('frequently', 2), ('misunderstood', 1), ('messages', 3), ('nomethoderror', 1), ('undefined', 1), ('somemethod', 1), ('someobjectsometype', 1), ('ty', 1), ('notifications', 1), ('railscast', 1), ('producthunt', 5), ('pitchbot', 3), ('vc', 1), ('discussion', 3), ('vetted', 1), ('investor', 2), ('reviews', 2), ('founders', 1), ('digitaltrends', 1), ('availability', 3), ('shows', 2), ('metro', 2), ('metropolitan', 1), ('worse', 1), ('driving', 1), ('downtown', 1), ('megaplex', 1), ('sudden', 1), ('horrifying', 1), ('realization', 1), ('arent', 1), ('anyparking', 1), ('spacesin', 1), ('sight', 1), ('editors', 2), ('recommendations', 2), ('julian', 1), ('chokkattu', 1), ('added', 3), ('official', 1), ('details', 6), ('theheavyprojects', 1), ('oakland', 1), ('designing', 2), ('imagined', 1), ('futures', 1), ('apple', 4), ('insas', 4), ('iti', 1), ('mt', 1), ('gifiti', 7), ('incredible', 2), ('hand', 4), ('painted', 2), ('animated', 7), ('murals', 2), ('artist', 4), ('insa', 3), ('brought', 1), ('platformthe', 1), ('term', 2), ('coined', 1), ('unique', 3), ('paintings', 1), ('street', 5), ('paradoxically', 1), ('viewable', 1), ('playing', 1), ('hyperreal', 1), ('laborious', 1), ('involving', 1), ('numerous', 1), ('layers', 1), ('painting', 1), ('meticulous', 1), ('planning', 2), ('artwork', 1), ('ends', 1), ('entails', 1), ('photographing', 1), ('layer', 1), ('paints', 1), ('images', 5), ('uploaded', 1), ('overlaid', 1), ('piece', 1), ('looping', 1), ('audiences', 2), ('described', 2), ('slices', 1), ('infinite', 1), ('unreality', 1), ('cutting', 4), ('edge', 1), ('tumblr', 1), ('generationnow', 1), ('chance', 2), ('lifethe', 1), ('creatorbritish', 1), ('began', 1), ('graffiti', 10), ('writer', 2), ('known', 3), ('worldwide', 1), ('trademark', 1), ('fetish', 1), ('pattern', 1), ('largescale', 1), ('signature', 2), ('envelopes', 1), ('bespoke', 1), ('furniture', 2), ('artists', 1), ('high', 2), ('heels', 1), ('cars', 1), ('yacht', 1), ('sails', 1), ('collectors', 1), ('homes', 1), ('held', 2), ('london', 3), ('exhibited', 1), ('tate', 1), ('britain', 1), ('galleries', 3), ('major', 3), ('cities', 2), ('tokyo', 1), ('york', 4), ('hong', 1), ('kong', 1), ('montrealhe', 1), ('customers', 3), ('bought', 1), ('stations', 1), ('targets', 5), ('userdefined', 1), ('runtime', 2), ('selected', 1), ('theyshare', 1), ('capabilities', 5), ('targetwith', 1), ('exceptionthat', 1), ('databases', 1), ('vzyqcrsdgd', 1), ('touchtag', 3), ('devicefeatures', 1), ('include', 3), ('silky', 1), ('drips', 1), ('respond', 1), ('accelerometer', 1), ('pens', 1), ('sprays', 1), ('laser', 1), ('pointers', 1), ('colours', 1), ('stroke', 1), ('scaling', 1), ('roadmap', 4), ('builder', 3), ('prodpad', 3), ('whatruns', 1), ('runs', 4), ('digitalocean', 1), ('tutorials', 9), ('anaconda', 3), ('distribution', 5), ('opensource', 1), ('programming', 14), ('report', 20), ('bug', 3), ('straightforward', 1), ('googleblog', 1), ('featured', 3), ('lenovo', 2), ('consumerready', 1), ('transforms', 1), ('lens', 1), ('blogs', 3), ('newatlas', 1), ('lzrtag', 3), ('goes', 2), ('several', 5), ('inch', 1), ('city', 6), ('transportation', 1), ('now', 1), ('fewer', 1), ('venue', 2), ('tagging', 1), ('choice', 1), ('calling', 3), ('aliens', 1), ('galactic', 1), ('neighbors', 1), ('gizmag', 1), ('pty', 1), ('vatphsqrvac', 1), ('difference', 2), ('rfid', 2), ('ble', 2), ('video', 7), ('differences', 2), ('describe', 2), ('marvelapp', 1), ('parkingspot', 1), ('immatriculationapi', 1), ('immatriculation', 2), ('chercher', 3), ('plaques', 2), ('dimmatriculation', 3), ('franaises', 4), ('obtenez', 2), ('marque', 1), ('modle', 1), ('numro', 1), ('chssis', 1), ('taille', 1), ('moteur', 4), ('autres', 1), ('champs', 1), ('partir', 19), ('plaque', 1), ('franaise', 3), ('contacteznous', 2), ('dessai', 1), ('gratuit', 1), ('multiplateformes', 1), ('travaille', 1), ('avezvous', 1), ('complmentaire', 1), ('vhicule', 1), ('pourraient', 1), ('intresser', 5), ('pourrons', 1), ('affaires', 1), ('sqlprep', 2), ('calculate', 2), ('supplier', 6), ('responsible', 3), ('output', 3), ('count', 5), ('descending', 2), ('alphabetic', 2), ('order', 5), ('customer', 4), ('highest', 3), ('credit', 5), ('limit', 3), ('connection', 3), ('tympanus', 3), ('searchuieffects', 1), ('effects', 6), ('codrops', 2), ('remarkable', 3), ('hunter', 2), ('jonathan', 1), ('tzou', 1), ('makers', 2), ('mats', 1), ('herding', 1), ('solberg', 1), ('typely', 2), ('english', 1), ('pandas', 4), ('travis', 1), ('enhancingperf', 1), ('highlightdataframe', 1), ('enhancing', 2), ('writing', 5), ('pure', 8), ('numpy', 1), ('sufficient', 1), ('computationally', 1), ('heavy', 2), ('achieve', 2), ('sizeable', 1), ('speedups', 1), ('offloading', 1), ('cython', 4), ('expression', 3), ('evaluation', 2), ('eval', 2), ('general', 5), ('dataframequerypandaseval', 1), ('evaluate', 1), ('subexpressions', 1), ('evaluated', 2), ('numexpr', 1), ('must', 4), ('transparently', 1), ('done', 1), ('inferring', 1), ('arguments', 2), ('operators', 2), ('kd', 1), ('awe', 6), ('owner', 1), ('wish', 1), ('ensure', 3), ('signed', 1), ('andor', 3), ('viewing', 2), ('recommend', 3), ('versions', 7), ('firefox', 3), ('safari', 7), ('emaiax', 1), ('scriptcam', 2), ('emaiaxscriptcamrails', 1), ('manipulate', 1), ('webcams', 1), ('snapshots', 1), ('detect', 1), ('movement', 1), ('faces', 1), ('colors', 3), ('qr', 1), ('barcodes', 1), ('record', 1), ('videoclips', 1), ('videochats', 1), ('noncommercial', 1), ('scriptcamrails', 2), ('contributing', 5), ('gemfile', 1), ('bundle', 1), ('linuxjournal', 1), ('shown', 1), ('dalvik', 3), ('relatively', 2), ('call', 5), ('awesome', 7), ('mathiasp', 1), ('seo', 22), ('quel', 3), ('taux', 5), ('clic', 4), ('fonction', 5), ('sil', 1), ('revient', 2), ('souvent', 1), ('lorsque', 2), ('lon', 1), ('rfrencement', 2), ('naturel', 2), ('celle', 1), ('concernant', 4), ('positionnement', 1), ('serp', 1), ('rsultat', 1), ('recherche', 10), ('relation', 2), ('cancel', 6), ('reply', 10), ('mentions', 2), ('lgales', 2), ('cveneziani', 1), ('cvenezianilewagonrailstemplates', 1), ('numbers', 12), ('snapchat', 4), ('combien', 3), ('rapporte', 3), ('utilisateur', 8), ('moyenne', 1), ('dollars', 1), ('contre', 2), ('quant', 1), ('chiffre', 1), ('impressionnant', 1), ('thenounproject', 1), ('noun', 2), ('handlebarlabs', 1), ('meteor', 2), ('thats', 2), ('dream', 1), ('asked', 5), ('month', 6), ('coupon', 1), ('discount', 1), ('handlebar', 1), ('labs', 1), ('ngauthier', 1), ('restful', 4), ('put', 3), ('replace', 1), ('peopleid', 3), ('attribute', 3), ('attributes', 3), ('col', 1), ('meetspace', 1), ('conferencing', 1), ('toloka', 1), ('yandex', 1), ('yandextoloka', 1), ('ytbryan', 1), ('httpsgithubcomytbryanhighlighting', 1), ('pull', 4), ('intended', 1), ('safe', 2), ('welcoming', 1), ('collaboration', 3), ('expected', 2), ('adhere', 1), ('conduct', 1), ('flarup', 1), ('fabian', 1), ('rikke', 1), ('koblauch', 1), ('moona', 1), ('head', 1), ('temperature', 1), ('sleep', 1), ('vimeo', 6), ('personal', 5), ('override', 2), ('tm', 3), ('fonts', 12), ('transparent', 1), ('collectui', 1), ('tracker', 4), ('daily', 6), ('collected', 3), ('archive', 2), ('beyond', 3), ('picked', 2), ('updating', 2), ('submit', 3), ('am', 2), ('timezone', 1), ('lareserveapi', 1), ('apiary', 4), ('booking', 2), ('rserve', 2), ('vkzlgcnwdjw', 1), ('op', 2), ('bflat', 2), ('minor', 5), ('httpgoogluwcenpatreon', 1), ('httpswwwpatreoncomatinpianofacebook', 1), ('httpwwwfacebookcomatinpianotwitter', 1), ('httpstwittercomatinpianosheets', 1), ('httpgooglxdcuzamidi', 1), ('thmp', 1), ('httpgooglaixilpits', 1), ('miguelgrinberg', 1), ('flask', 3), ('mega', 1), ('hello', 3), ('megatutorial', 1), ('documenting', 1), ('microframework', 1), ('categories', 4), ('documentwritenew', 1), ('dategetfullyear', 1), ('miguel', 1), ('grinberg', 1), ('cssreference', 1), ('grid', 4), ('twodimensional', 1), ('layout', 4), ('specifically', 2), ('tackle', 1), ('gridbased', 1), ('interfaces', 3), ('grids', 1), ('layouts', 1), ('sukeesh', 1), ('jarvis', 2), ('sukeeshjarvis', 1), ('tests', 4), ('telegraph', 1), ('solve', 5), ('chess', 4), ('holds', 3), ('consciousness', 3), ('can', 5), ('puzzle', 1), ('finally', 3), ('scientists', 1), ('uncover', 1), ('matched', 1), ('noticed', 1), ('adblocking', 1), ('marcel', 1), ('schwantes', 1), ('tell', 2), ('boss', 6), ('emotionally', 1), ('fakin', 1), ('emotional', 4), ('intelligence', 8), ('here', 4), ('truly', 2), ('wonder', 1), ('degree', 1), ('eq', 3), ('measure', 1), ('bosss', 1), ('competencies', 2), ('prolific', 1), ('bosses', 1), ('display', 1), ('offthecharts', 1), ('employees', 1), ('assessing', 1), ('longterm', 1), ('culture', 3), ('early', 2), ('onboarding', 1), ('showing', 3), ('curiosity', 1), ('role', 4), ('mission', 1), ('less', 3), ('path', 5), ('ncbi', 1), ('nlm', 1), ('nih', 1), ('gov', 1), ('pmc', 2), ('iparking', 2), ('an', 3), ('indoor', 4), ('locationbased', 4), ('positioning', 1), ('widely', 2), ('studied', 1), ('proposed', 1), ('substantial', 1), ('primitive', 1), ('experimental', 1), ('national', 2), ('biotechnology', 1), ('medicine', 1), ('rockville', 1), ('pike', 1), ('bethesda', 1), ('md', 1), ('usa', 2), ('presentation', 2), ('bzrbjnfoxdxmceekgmepy', 1), ('seewrvrvkngdrc', 1), ('editslideid', 1), ('ga', 1), ('lagxpywgthhibdtyspneemqzrjuxzspfgsa', 1), ('co', 1), ('editheadingh', 1), ('ghcuyc', 1), ('wqzfnxvpjfayjazetgjbvntijcwkzvaabxws', 1), ('uspembedfacebookuspembedfacebookuspembedfacebookuspembedfacebook', 1), ('botify', 1), ('meetup', 1), ('cloudflare', 10), ('hc', 1), ('configure', 5), ('https', 5), ('whichsupports', 1), ('meaningyou', 1), ('worry', 1), ('infrastructure', 1), ('instead', 4), ('describes', 3), ('serve', 1), ('traffic', 5), ('slow', 2), ('errors', 1), ('expecting', 1), ('spike', 1), ('omniauth', 5), ('callback', 5), ('firing', 3), ('failure', 6), ('invalid', 4), ('credentials', 4), ('implement', 3), ('controller', 2), ('fired', 1), ('imidiately', 1), ('skips', 1), ('message', 6), ('guest', 6), ('portail', 1), ('polytechnique', 2), ('datascience', 1), ('summer', 6), ('initiative', 2), ('organizing', 1), ('campus', 1), ('cole', 1), ('parissaclay', 1), ('august', 1), ('statstool', 2), ('statsanalysisranking', 8), ('statstoolcom', 4), ('owners', 6), ('webmasters', 6), ('retrieve', 4), ('ip', 6), ('optimization', 6), ('stats', 2), ('country', 2), ('various', 4), ('statistical', 6), ('valuation', 4), ('engagement', 2), ('safety', 2), ('whois', 2), ('geo', 1), ('spec', 1), ('defines', 2), ('scripted', 1), ('geographical', 1), ('associated', 2), ('section', 3), ('status', 3), ('supersede', 1), ('references', 1), ('requirements', 1), ('alec', 1), ('berntson', 1), ('alissa', 1), ('cooper', 1), ('steve', 1), ('block', 1), ('greg', 1), ('bolsinga', 1), ('lars', 1), ('erik', 2), ('bolstad', 1), ('aaron', 1), ('boodman', 1), ('burke', 1), ('chris', 2), ('butler', 1), ('max', 1), ('froumentin', 1), ('shyam', 1), ('habarakada', 1), ('marcin', 1), ('hanclik', 1), ('brad', 1), ('lassey', 1), ('angel', 1), ('machin', 1), ('mccormack', 1), ('daniel', 1), ('park', 1), ('stuart', 1), ('parmenter', 1), ('olli', 1), ('pettay', 1), ('prince', 1), ('arun', 1), ('ranganathan', 1), ('aza', 1), ('raskin', 1), ('carl', 1), ('reed', 1), ('roessler', 1), ('dirk', 1), ('segers', 1), ('allan', 1), ('thomson', 2), ('martin', 2), ('doug', 1), ('turner', 1), ('wilde', 1), ('matt', 1), ('womer', 1), ('mohamed', 1), ('zergaoui', 1), ('groundberry', 1), ('back', 9), ('four', 1), ('followed', 1), ('single', 6), ('subject', 1), ('spaced', 1), ('repetition', 1), ('store', 10), ('improving', 1), ('taggings', 1), ('cover', 3), ('authenticate', 1), ('reddit', 1), ('vkpx', 1), ('weekendhackprojectwithpairedprogramming', 1), ('weekend', 4), ('hack', 2), ('paired', 2), ('year', 7), ('little', 3), ('mvp', 1), ('seeing', 4), ('wanted', 3), ('whoa', 1), ('pardner', 1), ('reminder', 1), ('clients', 2), ('seconds', 1), ('avoid', 1), ('ninjaconcept', 3), ('dynamic', 5), ('directed', 1), ('graphs', 3), ('dacd', 1), ('forcedirected', 2), ('withd', 1), ('tremendous', 1), ('maintain', 2), ('understand', 4), ('analyse', 2), ('visualisation', 4), ('remedy', 1), ('communicate', 2), ('clearly', 1), ('efficiently', 1), ('improves', 1), ('overall', 1), ('guided', 1), ('simulations', 1), ('interaction', 2), ('hi', 1), ('consultancy', 1), ('leadingedge', 1), ('skills', 2), ('passion', 1), ('outstanding', 1), ('nilhcem', 1), ('bluetooth', 6), ('low', 5), ('energy', 5), ('communicating', 2), ('supports', 3), ('board', 4), ('wear', 1), ('hellocomet', 1), ('nous', 4), ('comet', 3), ('nouvelle', 2), ('manire', 2), ('travailler', 2), ('techdata', 3), ('connecte', 2), ('meilleurs', 3), ('freelances', 1), ('innovantes', 1), ('freelancers', 1), ('join', 5), ('talent', 1), ('findtech', 1), ('staff', 1), ('catalog', 2), ('fields', 2), ('vvhxhxhq', 1), ('nyman', 2), ('heart', 2), ('asks', 2), ('pleasure', 2), ('plutax', 2), ('midi', 1), ('visit', 5), ('httppianofoxnetdesign', 1), ('tshirts', 1), ('hoodies', 1), ('httpplutaxspreadshirtcomgoogle', 1), ('httpsplusgooglecomupeterplufacebook', 1), ('httpswwwfacebookcompeteraxon', 1), ('httpswwwfacebookcompa', 1), ('qreinventingorganizationclientms', 1), ('orange', 1), ('frprmdisvnsourcelnmstbmischsaxvedahukewjbyagibuahwhzrokhesiddmqauicsgbbiwbihtbmischqreinventingorganizationopaleimgrcnjjgghzyfpncm', 1), ('reinventing', 1), ('organization', 6), ('avanceaccueil', 1), ('aide', 3), ('envoyer', 1), ('commentaires', 2), ('wikipedia', 3), ('wiki', 9), ('scarendipitca', 1), ('srendipit', 3), ('dfinitions', 1), ('nombreuses', 1), ('externesmodifier', 1), ('externes', 4), ('doivent', 1), ('tre', 10), ('domaine', 1), ('il', 7), ('souhaitable', 1), ('prsente', 1), ('intrt', 1), ('citer', 1), ('comme', 3), ('enlever', 1), ('corps', 4), ('larticle', 1), ('optimove', 1), ('significance', 3), ('indicates', 1), ('recipients', 1), ('behavior', 9), ('forbidden', 4), ('fontsquirrel', 3), ('cac', 2), ('champagne', 2), ('american', 1), ('greetings', 1), ('while', 2), ('mailing', 2), ('squirrel', 6), ('bringing', 2), ('improvements', 3), ('generator', 3), ('ad', 4), ('blocker', 2), ('turned', 4), ('consider', 3), ('disabling', 2), ('partnersalternatively', 2), ('purchasing', 2), ('shopfontsquirrelcom', 2), ('makeinternetnoise', 1), ('noise', 2), ('march', 12), ('congress', 1), ('passed', 2), ('law', 1), ('legal', 1), ('providers', 1), ('isp', 2), ('sell', 8), ('activity', 2), ('means', 4), ('corporations', 1), ('genuinely', 1), ('interested', 3), ('thwarting', 1), ('efforts', 1), ('advertisers', 1), ('digitalarti', 1), ('digitalartimag', 1), ('philippeboisnardmetaphysiquedesflux', 1), ('philippe', 2), ('boisnard', 2), ('mtaphysique', 1), ('flux', 12), ('philosophe', 1), ('critique', 1), ('dart', 1), ('crivain', 1), ('artiste', 1), ('multimdia', 1), ('cesse', 1), ('dexplorer', 1), ('futur', 2), ('immdiat', 1), ('travers', 2), ('audiovisuelles', 1), ('dinstallations', 1), ('interactives', 1), ('crations', 1), ('mettant', 1), ('jeu', 8), ('incessant', 1), ('transitent', 1), ('suivez', 1), ('grand', 1), ('cru', 1), ('scopitone', 1), ('kgmid', 1), ('qgchlen', 1), ('frkgsfecffeecqmauricebenayounshndlsourcesh', 1), ('kpentrypointsh', 1), ('kp', 1), ('maurice', 2), ('benayoun', 2), ('searchsearch', 1), ('logicroom', 1), ('architecture', 6), ('explained', 3), ('modern', 11), ('interact', 3), ('seochat', 1), ('analyzer', 1), ('imageverifysxedhtimehshabbdgotoolurlwww', 1), ('concours', 1), ('oscaro', 1), ('comdisplaybothrelsubmitshowlinks', 1), ('threadwatchorg', 1), ('recovery', 1), ('devshed', 1), ('llcall', 1), ('forbes', 1), ('performing', 1), ('brain', 7), ('stress', 3), ('betterperforming', 2), ('originally', 2), ('appeared', 2), ('gain', 4), ('empowering', 2), ('others', 4), ('geoservices', 1), ('ign', 1), ('utilisationweb', 1), ('sdk', 5), ('htmlconfiguration', 1), ('dynamique', 1), ('clef', 4), ('daccs', 2), ('plateforme', 1), ('goportail', 1), ('paramtrer', 2), ('proprit', 1), ('geolocate', 1), ('positione', 1), ('permet', 2), ('dclencher', 1), ('sous', 3), ('dacceptation', 1), ('linternaute', 1), ('golocalisation', 1), ('consultant', 1), ('dutiliser', 1), ('coordonnes', 1), ('obtenues', 1), ('centrer', 1), ('carte', 2), ('mise', 2), ('oeuvre', 1), ('cre', 2), ('todobot', 1), ('edeeeaaf', 1), ('todo', 2), ('bot', 5), ('hubsy', 5), ('shops', 2), ('caf', 1), ('situe', 1), ('deux', 2), ('canal', 1), ('saint', 2), ('ancienne', 1), ('picerie', 1), ('entirement', 1), ('repense', 1), ('architecte', 1), ('daccueillir', 1), ('mistyped', 1), ('moved', 2), ('freethoughtblogs', 1), ('recursivity', 1), ('yeggman', 1), ('congratulations', 1), ('america', 1), ('elected', 1), ('racist', 1), ('sexist', 1), ('admitted', 1), ('sexual', 1), ('assaulter', 1), ('petty', 1), ('vindictive', 1), ('con', 1), ('man', 4), ('pathological', 1), ('liar', 1), ('office', 3), ('bbcf', 2), ('utc', 1), ('happened', 2), ('freecodecamp', 9), ('reacts', 4), ('jsx', 12), ('vue', 2), ('showdown', 3), ('ba', 1), ('vues', 2), ('vuejs', 1), ('planet', 1), ('pick', 1), ('similarities', 1), ('theyre', 3), ('thing', 2), ('publishes', 4), ('stories', 7), ('exactly', 1), ('hows', 1), ('bdcbd', 1), ('clientside', 2), ('andwhite', 1), ('dawn', 1), ('conventional', 1), ('onto', 1), ('yourhtml', 1), ('went', 2), ('white', 1), ('rubydoc', 1), ('faraday', 3), ('readme', 1), ('http', 2), ('lib', 1), ('adapters', 1), ('nethttp', 1), ('embraces', 1), ('rack', 1), ('requestresponse', 1), ('cycle', 1), ('httpclient', 1), ('rick', 1), ('olson', 1), ('zack', 2), ('hobson', 1), ('towards', 4), ('reducing', 3), ('dimensionality', 7), ('reduction', 4), ('techniques', 5), ('faecdfe', 1), ('demystify', 1), ('tsne', 1), ('auto', 5), ('encoders', 1), ('motivation', 3), ('mostly', 4), ('treated', 1), ('boxes', 1), ('therefore', 1), ('sometime', 1), ('misused', 1), ('sharing', 1), ('codes', 1), ('headline', 1), ('nonprofits', 1), ('yes', 1), ('challenge', 4), ('ctrl', 1), ('admin', 2), ('typeform', 4), ('workspaces', 1), ('utmcampaignrcystautmsourcetypeform', 1), ('basicutmmediumtypeformutmcontenttypeform', 1), ('thankyoubuttonutmtermen', 1), ('requires', 1), ('larger', 3), ('nonmobile', 1), ('email', 6), ('vctrcreplo', 1), ('cause', 4), ('analysis', 6), ('fabrizio', 1), ('cireddu', 1), ('wwwleanmanufacturingpdfcomhere', 1), ('transcript', 1), ('texttipsrulesroot', 1), ('collect', 1), ('vous', 6), ('souhaitez', 1), ('prsenter', 2), ('reportage', 1), ('contactez', 1), ('videofrenchwebfr', 1), ('dernires', 1), ('frenchwebjobs', 1), ('ovh', 1), ('kellermann', 1), ('roubaix', 1), ('france', 2), ('hackernoon', 1), ('eecadf', 1), ('translated', 2), ('jason', 1), ('cheng', 1), ('japanese', 2), ('postd', 1), ('korean', 1), ('han', 1), ('jaeyeab', 1), ('officially', 4), ('june', 1), ('tc', 1), ('seems', 1), ('talking', 1), ('noon', 1), ('hackers', 1), ('afternoons', 1), ('hippoar', 2), ('arkit', 8), ('hippoarreactnativearkit', 1), ('reactnativearkit', 4), ('binding', 1), ('save', 2), ('automatic', 1), ('installation', 2), ('reactnative', 2), ('manual', 3), ('xcode', 1), ('navigator', 1), ('feature', 3), ('always', 1), ('contributingmd', 1), ('guidelines', 1), ('dceac', 1), ('wwdc', 1), ('enters', 1), ('almosteverywhere', 1), ('iphone', 5), ('widespread', 1), ('hippo', 1), ('clapping', 1), ('signal', 1), ('stand', 1), ('codeship', 1), ('thinking', 2), ('showcase', 1), ('actioncable', 1), ('thought', 3), ('chat', 6), ('everybody', 1), ('builds', 1), ('dashboard', 4), ('kin', 8), ('adveen', 1), ('growbot', 3), ('directory', 8), ('inappropriate', 8), ('avk', 1), ('standuply', 3), ('abpbv', 1), ('facematch', 3), ('adrged', 1), ('niles', 4), ('organizes', 1), ('answers', 3), ('operations', 1), ('answering', 1), ('repeated', 1), ('questionssales', 1), ('close', 2), ('deals', 6), ('instant', 1), ('atdmz', 1), ('revise', 3), ('auaefhp', 1), ('quizdom', 3), ('ahpjhz', 1), ('hyphen', 3), ('productplan', 2), ('pjaegg', 1), ('ajsbh', 1), ('reviewq', 3), ('mudar', 1), ('parkcatcher', 1), ('mudarparkcatcher', 1), ('geojson', 1), ('spots', 1), ('allowed', 2), ('period', 1), ('panels', 1), ('descriptions', 1), ('deschtml', 1), ('slashdot', 3), ('story', 1), ('heard', 3), ('havent', 3), ('bennett', 1), ('haselton', 1), ('bestparking', 1), ('parkme', 1), ('nearby', 1), ('garages', 1), ('cheapest', 1), ('arriving', 1), ('leaving', 1), ('top', 10), ('migrate', 3), ('postgres', 3), ('amazon', 5), ('rds', 3), ('currently', 2), ('postgresql', 2), ('addon', 1), ('rows', 1), ('fill', 1), ('quite', 1), ('depending', 1), ('cope', 1), ('implementation', 4), ('sketchboard', 1), ('jazwzbtjqg', 1), ('sketchboardio', 1), ('sketch', 1), ('together', 1), ('teammates', 1), ('customise', 3), ('session', 5), ('separate', 2), ('at', 1), ('places', 7), ('currentuserroles', 1), ('fetch', 1), ('pundit', 4), ('jbuilder', 3), ('railsjbuilder', 1), ('encouraged', 1), ('propose', 3), ('fork', 2), ('value', 1), ('clubopeninnovation', 1), ('category', 1), ('cours', 6), ('club', 2), ('parisco', 1), ('safran', 3), ('environnement', 5), ('biomcanique', 2), ('reprsentatif', 2), ('volutif', 2), ('prexistant', 2), ('dintgrer', 2), ('grer', 3), ('interactions', 2), ('hommemachine', 2), ('clture', 2), ('dcembre', 2), ('biomcaniq', 1), ('zuehlke', 1), ('shiny', 1), ('appropriately', 1), ('hitting', 1), ('strapi', 2), ('strapistrapi', 1), ('priority', 1), ('influenced', 1), ('stability', 1), ('needs', 4), ('eta', 1), ('contributed', 1), ('alpha', 1), ('strapialpha', 1), ('release', 3), ('date', 3), ('ter', 4), ('aquitaine', 1), ('contacts', 2), ('une', 3), ('suggestion', 1), ('rclamation', 1), ('nhsitez', 1), ('par', 1), ('courrier', 1), ('caractre', 1), ('recueillies', 1), ('mobilits', 2), ('direction', 2), ('lobjet', 1), ('traitement', 1), ('responsabilit', 1), ('destin', 2), ('linformation', 1), ('voyageurs', 1), ('promotion', 1), ('doffres', 2), ('commerciales', 1), ('rserves', 3), ('lusage', 2), ('conformment', 1), ('dispositions', 1), ('loi', 2), ('janvier', 1), ('dite', 1), ('liberts', 1), ('toute', 2), ('personne', 2), ('justifiant', 1), ('identit', 1), ('peut', 9), ('exercer', 1), ('droits', 4), ('rectification', 1), ('suppression', 1), ('ainsi', 2), ('droit', 2), ('dopposition', 1), ('motif', 1), ('lgitime', 1), ('chant', 1), ('peuvent', 6), ('exercs', 1), ('rubrique', 1), ('contactsnous', 1), ('udacity', 4), ('nanodegree', 2), ('leverage', 1), ('reduxs', 1), ('strengths', 1), ('would', 2), ('scratch', 2), ('combining', 1), ('declarative', 1), ('expert', 2), ('tem', 1), ('uma', 1), ('pgina', 1), ('em', 1), ('portugus', 1), ('para', 1), ('voc', 1), ('local', 4), ('sprechen', 1), ('sie', 3), ('deutsch', 1), ('besuchen', 1), ('deudacitycom', 1), ('und', 2), ('entdecken', 1), ('lokale', 1), ('angebote', 1), ('unsere', 1), ('partnerunternehmen', 1), ('udacitys', 1), ('deutschsprachigen', 1), ('sexes', 1), ('liberation', 3), ('hommes', 4), ('phobiques', 3), ('lengagement', 3), ('vit', 1), ('poque', 1), ('bizarre', 1), ('veulent', 2), ('bague', 1), ('doigt', 1), ('porter', 1), ('belle', 2), ('robe', 1), ('blanche', 1), ('de', 3), ('lautre', 1), ('juste', 4), ('samuser', 1), ('ontils', 1), ('sengager', 1), ('ou', 1), ('craignentils', 1), ('srieuses', 1), ('prcdent', 1), ('rss', 3), ('parismatch', 1), ('sexisme', 3), ('chez', 5), ('biologique', 4), ('labsence', 1), ('seraitelle', 1), ('due', 1), ('diffrence', 1), ('semble', 2), ('penser', 1), ('employ', 1), ('expliqu', 1), ('note', 6), ('dvoile', 1), ('amricains', 1), ('christine', 1), ('boutin', 1), ('fin', 1), ('carrire', 1), ('vbvzvc', 1), ('ts', 1), ('understanding', 4), ('weird', 2), ('parts', 3), ('hour', 4), ('sale', 1), ('httpswwwudemycomunderstandjava', 1), ('normal', 1), ('price', 1), ('everyone', 4), ('deep', 3), ('hoodin', 1), ('enhance', 2), ('abilities', 1), ('javas', 1), ('codecademy', 4), ('bwa', 1), ('contains', 3), ('documetation', 1), ('math', 2), ('lines', 3), ('dafcd', 1), ('ofcode', 1), ('train', 1), ('synapticjs', 1), ('simplest', 1), ('manages', 1), ('xor', 1), ('equation', 1), ('jammed', 3), ('cfbeac', 1), ('mediumarticle', 1), ('wrote', 2), ('short', 1), ('summarize', 2), ('humans', 4), ('matters', 2), ('fafdf', 1), ('picture', 2), ('artificial', 4), ('learningpast', 1), ('supervised', 1), ('linear', 1), ('regression', 1), ('functions', 2), ('overfitting', 1), ('gradient', 1), ('descent', 1), ('plainenglish', 1), ('explanations', 1), ('accompanied', 1), ('realworld', 1), ('demystifying', 1), ('intentional', 1), ('ai', 1), ('positive', 1), ('impact', 3), ('numerama', 3), ('ampproject', 2), ('enquete', 1), ('figaro', 3), ('lequipe', 1), ('closer', 3), ('participent', 3), ('pistage', 3), ('francais', 1), ('amp', 2), ('enqute', 2), ('lquipe', 3), ('franais', 4), ('teemo', 1), ('exdataberries', 1), ('lorsquon', 3), ('reoit', 1), ('mcdonalds', 1), ('systme', 2), ('carrefour', 1), ('nhsite', 1), ('mettre', 1), ('plats', 1), ('grands', 1), ('convaincre', 1), ('supriorit', 1), ('technologique', 1), ('bote', 1), ('whos', 2), ('rservs', 2), ('propos', 1), ('wildcodeschool', 1), ('mois', 6), ('wild', 2), ('affaire', 1), ('persvrance', 1), ('doit', 4), ('agrable', 1), ('graphique', 1), ('efficace', 1), ('grce', 1), ('intelligente', 1), ('ergonomique', 1), ('devenir', 1), ('notre', 1), ('meteojob', 2), ('trainings', 2), ('trewtmtcttkzftmvdgzvcmhdglvbg', 1), ('angularjs', 1), ('mthode', 2), ('agile', 1), ('programmation', 1), ('symfony', 1), ('prestashop', 1), ('sql', 1), ('titre', 10), ('professionnel', 9), ('rncp', 1), ('thorique', 1), ('centre', 3), ('dveloppeurse', 2), ('logiciel', 2), ('envisages', 1), ('aprs', 1), ('analys', 1), ('besoins', 1), ('utilisateurs', 1), ('etou', 1), ('dveloppeureuse', 1), ('programme', 4), ('dlnf', 1), ('ecole', 1), ('webstart', 2), ('lcole', 1), ('mtiers', 1), ('metier', 1), ('tl', 1), ('lancement', 1), ('anne', 2), ('groupe', 2), ('mjm', 1), ('graphic', 1), ('fond', 1), ('tmdbltffmdb', 1), ('kevinbinz', 1), ('ml', 2), ('tribes', 3), ('research', 4), ('aiand', 1), ('decades', 1), ('indeed', 1), ('textbook', 1), ('approach', 3), ('dizzying', 1), ('variety', 1), ('inference', 1), ('schemes', 2), ('leave', 6), ('smartbox', 3), ('beneficiary', 1), ('voucher', 1), ('cbdafddaaaaedbabfacfaaecaeebc', 1), ('recevoir', 2), ('promotionnelles', 1), ('exclusives', 1), ('meilleures', 1), ('partenaires', 1), ('slectionns', 1), ('nouveau', 2), ('utiliss', 1), ('proposer', 1), ('adapts', 1), ('centres', 1), ('dintrt', 1), ('mesurer', 13), ('frquentation', 1), ('cliquez', 1), ('gferdcreiuaekwaofmfuxtazhmgp', 1), ('youtube', 1), ('gmail', 2), ('drive', 3), ('settings', 3), ('advertisingprogramsbusiness', 1), ('solutionsgoogleabout', 1), ('confidentialit', 3), ('ycombinator', 2), ('arcore', 4), ('thatsnot', 1), ('comparison', 7), ('million', 3), ('rough', 1), ('apples', 1), ('sse', 1), ('hardware', 2), ('fragmentation', 1), ('tough', 1), ('gpsbusinessnews', 1), ('servicesr', 1), ('gps', 8), ('schneider', 1), ('electric', 1), ('unibail', 1), ('rodamco', 1), ('connexient', 1), ('speaking', 1), ('theverge', 3), ('announce', 1), ('samsung', 5), ('week', 4), ('showed', 2), ('oz', 3), ('kind', 2), ('wizard', 1), ('bag', 2), ('dieter', 1), ('bohn', 1), ('vox', 1), ('espritsciencemetaphysiques', 1), ('augmenter', 1), ('dopamine', 5), ('faons', 3), ('daugmenter', 3), ('cerveau', 3), ('niveaux', 1), ('faibles', 1), ('causer', 1), ('dpression', 1), ('perte', 1), ('satisfaction', 1), ('envies', 1), ('compulsions', 1), ('faible', 1), ('libido', 1), ('incapacit', 1), ('concentrer', 1), ('esprit', 1), ('mtaphysiquescom', 1), ('nouvelles', 2), ('cherche', 1), ('briser', 1), ('chanes', 1), ('pense', 1), ('conventionnelle', 1), ('rsonance', 1), ('voyez', 1), ('pouvez', 5), ('lune', 1), ('icnes', 1), ('cidessous', 1), ('crdit', 1), ('limage', 1), ('principale', 1), ('jones', 1), ('androidjonescom', 1), ('cuisineaz', 1), ('recettes', 1), ('tajine', 6), ('poulet', 6), ('pruneaux', 5), ('amandes', 5), ('aspx', 1), ('prparation', 3), ('tape', 2), ('revenir', 1), ('morceaux', 1), ('sauteuse', 1), ('directement', 5), ('lhuile', 1), ('quils', 1), ('dors', 1), ('cuits', 1), ('retirezles', 1), ('remplacezles', 1), ('oignons', 1), ('baissant', 1), ('feu', 1), ('cocotte', 1), ('brunir', 1), ('avis', 1), ('recette', 2), ('howwegettonext', 1), ('abdfef', 1), ('yourphone', 1), ('bc', 1), ('socrates', 2), ('worried', 1), ('peoples', 1), ('brains', 2), ('younger', 1), ('scholars', 1), ('oral', 1), ('argued', 1), ('felt', 1), ('forgetfulness', 1), ('learners', 1), ('souls', 1), ('memories', 1), ('smartphones', 1), ('thinkbecause', 1), ('inspiring', 1), ('steven', 1), ('johnson', 1), ('edited', 1), ('steadman', 1), ('duncan', 1), ('geere', 1), ('anjali', 1), ('ramachandran', 1), ('elizabeth', 1), ('minkel', 1), ('supported', 3), ('gates', 1), ('vnkluytub', 1), ('knight', 3), ('httpsgooglqbpufythe', 1), ('versionpiano', 1), ('marketoonist', 2), ('deadly', 3), ('sins', 3), ('easiest', 1), ('gauge', 2), ('innovative', 1), ('unchecked', 1), ('carries', 1), ('stigma', 1), ('paralyze', 1), ('marketoon', 1), ('dieti', 1), ('natura', 1), ('maitake', 1), ('maitak', 2), ('matak', 2), ('stimule', 1), ('immunitaire', 1), ('donne', 1), ('tonus', 1), ('organisme', 1), ('lorsquil', 1), ('besoin', 1), ('champignon', 1), ('brun', 1), ('lamellaire', 1), ('utilis', 1), ('depuis', 1), ('longtemps', 1), ('cuisine', 1), ('asiatique', 1), ('japon', 1), ('chine', 1), ('huile', 1), ('vitamine', 1), ('produit', 2), ('rapprovisionnement', 1), ('sant', 1), ('mangez', 1), ('fruits', 1), ('lgumes', 1), ('jour', 6), ('pratiquez', 1), ('activit', 1), ('physique', 1), ('rgulire', 1), ('vitez', 1), ('manger', 1), ('trop', 3), ('gras', 1), ('sucr', 1), ('sal', 1), ('grignoter', 1), ('repas', 1), ('candidat', 6), ('pole', 6), ('emploi', 10), ('detail', 7), ('intgrateur', 1), ('ralisation', 1), ('dapplications', 1), ('tant', 2), ('financeur', 2), ('ple', 2), ('sassurer', 2), ('organismes', 2), ('dispensent', 2), ('qualit', 2), ('rpondant', 2), ('dcret', 2), ('juin', 2), ('dapplication', 1), ('spcialisation', 1), ('tiramisu', 3), ('oreos', 1), ('oros', 2), ('photo', 1), ('grammes', 1), ('aller', 1), ('loin', 1), ('buzz', 1), ('premire', 1), ('commenter', 1), ('codeburst', 2), ('doctor', 2), ('aeabd', 1), ('doctorwho', 1), ('reasons', 2), ('coders', 2), ('evaluating', 1), ('fixing', 1), ('bursts', 1), ('thriveglobal', 1), ('quitting', 3), ('walked', 1), ('unknown', 1), ('resigned', 1), ('studies', 1), ('plans', 5), ('threemonth', 1), ('sabbatical', 1), ('thrive', 2), ('anna', 3), ('lundberg', 1), ('coach', 1), ('speaker', 1), ('helping', 1), ('reimagine', 1), ('onestepoutsidecom', 1), ('jdecool', 1), ('veille', 2), ('primordial', 1), ('rester', 2), ('garder', 1), ('oeil', 1), ('volutions', 1), ('mtier', 5), ('aussi', 8), ('produits', 1), ('processus', 1), ('amens', 1), ('utiliser', 2), ('quotidien', 2), ('essentiel', 1), ('laposte', 1), ('outils', 1), ('bureau', 2), ('poste', 2), ('debussy', 2), ('mercredi', 1), ('septembre', 2), ('heures', 2), ('douverture', 1), ('accessibilit', 1), ('limites', 1), ('dpt', 1), ('dformoso', 1), ('mindmap', 2), ('dformosomachinelearningmindmap', 1), ('subfield', 1), ('explicitly', 1), ('programmed', 1), ('explores', 1), ('construction', 1), ('predictions', 1), ('fascinating', 1), ('broad', 1), ('scope', 2), ('cheatsheet', 1), ('me', 1), ('missing', 2), ('brainteasing', 1), ('fullstack', 4), ('interview', 1), ('containing', 1), ('tiles', 1), ('vfmwrridqfle', 1), ('yoga', 3), ('corbeau', 3), ('yogafactory', 1), ('explique', 2), ('avec', 3), ('astuces', 2), ('na', 1), ('facile', 1), ('xavierdupre', 1), ('teachpyx', 1), ('helpsphinx', 1), ('clang', 1), ('variables', 2), ('impossible', 2), ('variable', 1), ('terme', 1), ('dsigne', 1), ('dattribuer', 1), ('identificateur', 1), ('nommant', 1), ('facilement', 1), ('accentus', 1), ('objets', 1), ('internes', 1), ('borderline', 2), ('biz', 1), ('barter', 3), ('group', 7), ('viber', 1), ('whatsapp', 1), ('multiplatform', 1), ('enthusiasm', 1), ('dwindles', 1), ('someone', 3), ('marketplace', 1), ('away', 1), ('elses', 1), ('excites', 1), ('letting', 1), ('starve', 1), ('waste', 1), ('engineering', 3), ('housing', 2), ('aac', 1), ('nativeapp', 1), ('launched', 3), ('pwa', 1), ('aim', 3), ('inconsistent', 1), ('connections', 1), ('strive', 1), ('letsgofrance', 1), ('talents', 1), ('applis', 4), ('francaises', 1), ('simplifieront', 3), ('rentree', 1), ('rentre', 3), ('promis', 1), ('laisserez', 1), ('dborder', 1), ('dhorizon', 1), ('aideront', 1), ('semaines', 1), ('venir', 1), ('dp', 1), ('harness', 2), ('items', 5), ('most', 3), ('prime', 1), ('entreprendre', 1), ('temoignages', 1), ('lance', 1), ('lanc', 2), ('lit', 1), ('conseils', 1), ('mais', 2), ('choses', 1), ('reviennent', 1), ('assez', 1), ('vite', 2), ('regrouper', 1), ('profils', 1), ('intgrer', 1), ('profil', 1), ('fondatrice', 1), ('aimatmelanoma', 1), ('stades', 1), ('melanome', 2), ('stade', 4), ('iv', 4), ('mlanome', 3), ('dans', 6), ('sest', 1), ('propag', 1), ('audel', 1), ('ganglion', 1), ('lymphatique', 1), ('rgional', 1), ('rgions', 1), ('loignes', 1), ('ldh', 1), ('estil', 1), ('important', 5), ('dauteur', 1), ('copie', 1), ('melanoma', 1), ('dutilisation', 1), ('sponsors', 1), ('propuls', 1), ('tdahadulte', 1), ('capacite', 1), ('dadaptation', 3), ('personnelle', 3), ('changement', 3), ('capacit', 2), ('questionnaire', 1), ('rempli', 1), ('lu', 1), ('trouv', 1), ('rponses', 1), ('puis', 1), ('dtermin', 1), ('voulez', 1), ('prt', 1), ('mesure', 2), ('dinvestir', 1), ('minimum', 1), ('participer', 1), ('pro', 3), ('mentorat', 1), ('priv', 1), ('disponible', 1), ('pluralsight', 2), ('aidabamaaasoidpromoutmcampaignjavascript', 1), ('skillscore', 1), ('facebookutmcontentutmmediumsocialmedia', 1), ('paidutmsourcefacebookutmterm', 1), ('languageit', 1), ('feels', 2), ('fix', 1), ('problems', 1), ('rapid', 1), ('register', 2), ('activating', 1), ('benefit', 2), ('abide', 1), ('pluralsights', 1), ('huffingtonpost', 1), ('bientot', 1), ('reservees', 1), ('covoitureurs', 3), ('ile', 1), ('francea', 1), ('des', 2), ('bientt', 2), ('ledefrance', 2), ('lledefrance', 1), ('annonc', 1), ('lundi', 1), ('ensemble', 1), ('mesures', 1), ('encourager', 1), ('covoiturage', 1), ('absolument', 1), ('crucial', 1), ('selon', 2), ('prsidente', 1), ('valrie', 1), ('pcresse', 1), ('lutter', 1), ('embouteillages', 1), ('pollution', 1), ('complment', 1), ('transports', 1), ('commun', 1), ('httpmhuffingtonpostfr', 1), ('huffpost', 2), ('vidos', 2), ('rater', 1), ('quotidienne', 1), ('infos', 2